Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045675-GRMZM2G394528
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273109
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.2584417060261
Log2 mRNA fold difference:3.4002128107372
Log2 TE fold difference:-1.8818766388184
Sequences
Protein sequence

MSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPARAFDMAHCSRCLIPWQLYDGLYL
IEVDRVLRPGGYWILSGPPINWKKYWKGWERTKEDLNAEQQAIEAVARSLCWTKVKEAGD
IAVWQKPYNHAGCKASKSPPFCSRKNPDAAWYDKMEACITPLPEVSSARDVAGGAVKKWP
QRLTAVPPRVSRGTIKGVTARSFAQDTALWRKRVRHYKSVISQFEQKGRYRNVLDMNARL
GGFAAALASAGDPLWVMNMVPTVGNTTTLGAIYERGLIGSYQDWCEGMSTYPRTYDLIHA
DSVFTLYRNRCQMDRILLEMDRILRPRGTVIIREDVDLLVKVKSLADGMRWESQIVDHED
GPLVREKILLVVKTYWTAHEAMTKISSRTVK*

MGVRSAATKLHIPPSAARRPTFLPFVAVLLLCSASYLIGVWQHGGFATPSDKPAAVSTAT
AVACTNVAAAPKRRTRSGASSPSLDFSARHAAAADDALDASTATAASSAAPRRSSYPACP
ARYSEYTPCEDVERSLRFPRDRLVYRERHCPASERERLRCLVPAPPGYRTPFPWPASRDV
AWFANAPHKELTVEKAVQNWIRVDGDRLRFPGGGTMFPNGADAYIDDIAKLVPLHDGSIR
TALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPA
RAFDMAHCSRCLIPWQLYDGLYLIEVDRVLRPGGYWILSGPPINWNKYWKGWERTKEDLN
AEQQAIEAVARSLCWTKVKEAGDIAVWQKPYNHAGCKASKSSRPFCSRKNPDAAWYDKME
ACITPLPEISKASDVAGGAVKRWPQRLTAVPPRVSRGTVRGVTARSFAQDTELWRRRVRH
YKSVASQLEQKGRYRNVLDMNARLGGFAAALALAGDPLWVMNMVPTVANATTLGAIYERG
LIGSYQDWCEGMSTYPRTYDLIHADSVFTLYKDRCEMDRILLEMDRILRPRGTVIVREDV
DMLVKVKSLADGMRWESQIVDHEDGPLVREKILLVVKTYWTAQDQDQ*

Other information
Ka divergence:0.243251KaKs divergence:0.298794
GC content 1 (%):64GC content 2 (%):69GC content divergence:0.038
Length 1 (bp):1176Length 2 (bp):1944Length divergence:0.246
MFE 1 (kcal):-532.4MFE 2 (kcal):-975.72MFE divergence0.294