Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045921-GRMZM2G085336
Species:maize
Duplication type:WGD
Function (paralog1):structural constituent of ribosome
Function (paralog2):structural constituent of ribosome

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.58784846895876
Log2 mRNA fold difference:1.6103736575354
Log2 TE fold difference:-2.2368793199723
Sequences
Protein sequence

MSGSAFNAFKSRVPVAWSPRLYITLVRGLPGTRRLHRRTLEAMRLRRCHRTVEHRTTPSL
LGMLTQVKRLVAVETEEMYNARKQAEAERRAPRPPLVVSHHQPPPPALKPAAAAAEGAAA
TAP*

MSGSAFNAFKSRVPVAWSPRLYITLVRGLPGTRRLHRRTLEAMRLRRCHRTVEHRTTPSL
LGMLTQVKRLVAVETEEMYNARKQAEAERRAPRPPLVVSHQPQPPAPKPAAAAAVGAATT
AQ*

www.000webhost.com

Other information
Ka divergence:0.332378KaKs divergence:0.999931
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):372Length 2 (bp):369Length divergence:-0.004
MFE 1 (kcal):-175MFE 2 (kcal):-185.4MFE divergence0.029