Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046005-GRMZM2G180575
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100191844
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.77032135387579
Log2 mRNA fold difference:-0.57054684329703
Log2 TE fold difference:-0.20064764216765
Sequences
Protein sequence

MRAPAMLRWAAAALAALLAASPAAAFYLPGVAPNDFHKKDPLLVKVNKLTSTKTQLPYSY
YSLPFCKPNTIVDSAENLGEVLRGDRIENSPYVFEMGEPKMCQIICKAKIDDKQAKELKE
KIEDEYRVNMILDNLPLVVPLARQDRGATVYQAGYHVGVKGQYAGNNDKKSFIHNHLAFL
VKYHKDETTDLSRIVGFEVKPFSINHQFEGPWNDKNTRLITCDPHASKLLVNSDTPQEVE
AGKEIIFTYDVGFEESDIKWASRWDTYLLMIDDQIHWFSIVNSLMIVLFLSGMVAMIMLR
TLYRDISRYNQLETEEETQEETGWKLVHGDVFRPPANSDLLCVCVGTGVQFFGMLLVTMI
FAVLGFLSPSNRGGLMTAMLLTWVLMGLFAGYASSRLYKMLKGSEWKSITLRTAFLFPGI
AFGIFFVLNALIWGEKSSGAVPFTTMFALVLLWFGISVPLVFVGSYLGFKQPAIEAPVKT
NKIPRQVPEQAWYMNPAFTILIGGILPFGAVFIELFFILTSIWLHQFYYIFGFLFLVFII
LIVTCAEITIVLCYFQLCSEDYLWWWRSFLTSGSSAIYLFLYAGFYFFTKLQITKVVSGM
LYFGYMLLASFAFCVLTGTIGFYACFCFTRLIYSSVKID*

MRAPAMLRWAAAALAALLAASPAAAFYLPGVAPNDFHKKDPLLVKVNKLTSTKTQLPYSY
YSLPFCKPNTIVDSAENLGEVLRGDRIENSPYVFEMGEPKMCQIICKAKIDDKQAKELKE
KIEDEYRVNMILDNLPLVVPIARQDRGATVYQAGYHVGVKGQYTGNNDEKSFIHNHLAFL
VKYHKDETTDLSRIVGFEVKPFSINHQFEGPWNDKNTRLITCDPHASKLVVNSDTPQEVE
AGKEIIFTYDVGFEESDIKWASRWDTYLLMIDDQIHWFSIVNSLMIVLFLSGMVAMIMLR
TLYRDISRYNQLETEEEAQEETGWKLVHGDVFRPPANSDLLCVCVGTGVQFFGMLLVTMI
FAVLGFLSPSNRGGLMTAMLLTWVLMGLFAGYASSRLYKMLKGSEWRSITLRTAFLFPGI
AFGIFFILNALIWGEKSSGAVPFTTMFALVLLWFGISVPLVFVGSYLGFKQPAIEAPVKT
NKIPRQVPEQAWYMNPAFTILIGGILPFGAVFIELFFILTSIWLHQFYYIFGFLFLVFII
LIITCAEITIVLCYFQLCSEDYLWWWRSFLTSGSSAIYLFLYAGFYFFTKLQITKVVSGM
LYFGYMLLASFAFCVLTGTIGFYACFCFTRLIYSSVKID*

Other information
Ka divergence:-0.512722KaKs divergence:-0.559686
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1920Length 2 (bp):1920Length divergence:0
MFE 1 (kcal):-620.72MFE 2 (kcal):-633.94MFE divergence0.011