Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046101-GRMZM5G858249
Species:maize
Duplication type:WGD
Function (paralog1):glucan endo-1,3-beta-glucosidase 7
Function (paralog2):hypothetical protein LOC100273173

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4658948487182
Log2 mRNA fold difference:1.486337602773
Log2 TE fold difference:-0.022302114575404
Sequences
Protein sequence

MGAAARKPAAALLPIWLCLVCVSRAQPYIGVNYGEVADNLPSPDKTARLLKSTSISKVRL
YGVDAGLIRALAGSGISVVVGVANGEIPTLAADPAAASRWLAANVLPFVPATTISAVAVG
NEVLESGDAALAAALLPAMQNLRAAAAAAGDGAAGIRFSTVNTMGVMAQSEPPSAGAFHP
DVAPQLQQILGFLSKTGAPFMVNPYPWFAYQSDPRPETLAFCLFQPNAGRVDGGSKVRYA
NMFDAQLDAVKSALVRAGYGGVDIVVAETGWPTRGDAGEPGATVENARAYVSNLVAHLRS
GAGTPLMPGRSVDTYLFALYDEDLKPGPTSERSFGLYHTDLTMAYDAGLTSNSNAGGGTG
TAAPAQPKAGGWCVARDGASDAELQADLDYACSQVGVDCGAIQPGGACFEPNTVHAHAAY
AMNQLYQAAGRQPWNCDFRASATLTSENPSYGACVYTGGGQ*

MQNLRAAAAAAGGGAAGIRFSTVNTMGVMAQSDPPSTGAFHPDVAPQLQQILGFLSRTGA
PFMINPYPWFAYQSDPRPDTLAFCLFQPNAGRVDGGSKIRYTNMFDAQLDAVKSALVRAG
YGDVDVVVAETGWPTRGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFA
LYDEDLKPGPTSERSFGLYHTDLSMAYDAGLASSAAAGGRGGGGGGAAQPRGGGWCVARA
GASDAELQADLDYACSQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGRHPWNCD
FRASATLTSDDPSYGACVYTGGGQ*

Other information
Ka divergence:0.0386391KaKs divergence:-0.188535
GC content 1 (%):72GC content 2 (%):73GC content divergence:0.007
Length 1 (bp):1386Length 2 (bp):975Length divergence:-0.174
MFE 1 (kcal):-749.8MFE 2 (kcal):-535.1MFE divergence-0.167