Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046231-GRMZM2G025248
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):adenosine 5'-phosphosulfate reductase 9

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVRYRGSKDLNSLVDFYKETTGLDPIAYIDVVEQESTGSLSSVMPWDRSIREMAKDEMYL
LVAVLFIIVKVVAHFIPVVMSHLRAFLVVRVQNLNLGIRRGSNQLLERALNVLDVRRLWS
KLRLSNKATDLRKGANNARAWASSFPSVSLGEPSSSRQA*

MRCAAAALAVALIAVVAGATAPGSPAAGTCARRGALPFLDAVGSRCPFVRIEPSPPLEVR
GEAVDTELNLRRRGASYSILFYAAWCPFSSKFRPIFETVSTMYPQVHHFAVEESSATPSL
FSRYGVRGFPAILLVNETTMVRYRGSKDLNSLVDFYKETTGLDPVAYIDVVVQQESTASL
SSVAPWDRSPLEMAKDEPPYLLVAVLFIILKAAARLVPAAMSHLRAFLAVRVQNLNLGIR
RGSSQVLERALNALDVRRLCSKLGLSNRATDLRKGASNARAWASSFASVSLGEPSSSRQA
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):55GC content divergence:0.122
Length 1 (bp):480Length 2 (bp):903Length divergence:0.306
MFE 1 (kcal):-135.9MFE 2 (kcal):-349.6MFE divergence0.44