Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046402-GRMZM2G097499
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273515
Function (paralog2):hypothetical protein LOC100383233

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.48340695971383
Log2 mRNA fold difference:-0.24580663583285
Log2 TE fold difference:0.66570972600886
Sequences
Protein sequence

MERSEPSLKPEWLLRPTVPATTHKPVTSPRADDHGRGASSRNRSSGRDRDRSSQQSSSRR
GSSSSGSRRNDRDGTGKSRGYGNFGKHSKDRIQEKDLDFRERESRLVQPDDPLRDGFESF
SSCRSEKDRLNRTRSKVAIPNRAGVSLDNGNVSKKDNGVISFEREFPHLGSEDKNGKQDI
GRVPSPGISTPIQNIPLVVSDGWNSVLAEVPALVDPNINSVSSSSSPAGSSKPIEVSNSG
SALSMAETVMQSPLNICTTPQLSIDAQKIEERTMRQCILRPLTPSSNKISASISLDKLLK
SKGARAGESNGPIKVAPQLSIQPSSNSVRTPVKTELVKQSQSGSLQVLSREQNGTVNTAA
KDITSNNPVSPVLGRSSSMEPMRKSIVNPKLKVGTNGRSLHPLQGSFADRKASAKDKYKF
FELLRSKSVNGSSAAIESPSSLTDDQQNSSPELPFKFIENGNSSCEEANSCEGSQRHLSD
NEEIIPPSESHDVLDEGSLGIQVDDKGSSSSPVLGTQDISSKKPQEDNVDIVVPVYVNDG
SVMPNSVDNEARLLLEEANPAQVLQHIDAREENPCPAQEFESIGAGGEEELNLLRSMGWD
ENEEVQPLQQEEIADCVRQNVRLQQKLQECRG*

MERSEPSLKPEWLLRPTVPATTYKPATLPHTDDHGRGASSRNRSSGRDRDRSSQHSSSRR
GSSSSGPRRNDRDGIGKSRGYGNFGKHNKERIQEKDLDFRDRESRLVQSDDPLRDGFESF
SSCRSEKDRLNRTRSKVAISNRAVGVSLDNGNVSKKDNGVISFEREFPHLDSEDKNGKQD
IGRVPSPGISTPIQNIPLVVSDGWNSVLAMLGDPNINSVSSSSTHAGSSKQTEVSNSGSA
LSMAETVMQSPLKISTTPQLSIDAQKIEERTMRQCILRPLTPSSNKIPASSSLDKLLKSK
GARAGESNGPIKVAPQLSTQPSSNSVRTPVKTELVKQSQSGSLQVLSREQNGAVNTAAKD
STSNPVSPVLGRSSSMEPMRKSIVSPKLKVGTNGRSLHPLQGSFADRKASAKDKYKFFEM
LRSKSVNGSSAAIESPSSLTDDQQNSNLDLPFKFIENGSSSCEEANSCEGSQRHLSDNET
IPPSESHDVLDEGSLGIQVEDKDVSSSQVLGGTQDLSSKKPQEDNVNIVPIVPVYVNDGL
MMPNSVDDEASLPLEETNPAEVLQHIGAGEENPCPAQEFESIGAGGEEELNLLRSMGWDE
NEDVQPLQQEEIADCLKQNVRLQQKLQECKG*

Other information
Ka divergence:0.110434KaKs divergence:0.00506197
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1899Length 2 (bp):1896Length divergence:-0.001
MFE 1 (kcal):-603.62MFE 2 (kcal):-589.6MFE divergence-0.012