Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046748-GRMZM2G050371
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280306
Function (paralog2):ornithine carbamoyltransferase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.27520613660767
Log2 mRNA fold difference:-0.35050274948186
Log2 TE fold difference:0.62321918199183
Sequences
Protein sequence

MMAAAAISGSSGHLVVSSPRFRQPLTLPSRSGRPIAAAASAVARGGVAVAAVSSPAVSAV
AGKDAKQAPKDFLHINDFDKDTIMNILNRAIEVKAAIKSGDRSFQPFNGKSMAMIFAKPS
MRTRVSFEAGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILD
LAKYAAVPVINGLTDYNHPCQIMADALTMLEHVGRIENTKVVYVGDGNNIVHSWLLLAAV
LPFHFVCACPKGFEPDAKTVEIARSAGISKIEITNDPREAVKGADVVYTDVWASMGQKEE
ADYRKQKFQGFTVDEALMEIAGPQAYLMHCLPAERGVEVTDGAIEAPNSIVFPQAENRMH
AQNAIMLHVLGA*

MTPAAAISGSSSHVVVSSARLRQPFTLPPRTACPIAAAASPVTRRGVAVAAVSSPVVSAA
AGKDAKQAPKDFLQIIDFDKDTIMKILNRAIEVKALIKSGDKSFQPFKGKTMAMIFAKPS
MRTRVSFETGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQDILD
LAKYASVPVINGLTDYNHPCQIMADALTMLEQIGRIENTKVVYVGDGNNIVHSWLLLAAV
LPFHFVCACPKGFEPDANTVEIARSAGISKIEITNSPREAVKGADIVYTDVWASMGQKEE
ADYRKQKFQGFTVDEALMEIAGPQAYLMHCLPAERGVEVTDGAIEAPNSIVFPQAENRMH
AQNAIMLHVLGA*

Other information
Ka divergence:0.116492KaKs divergence:-0.0725014
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):1119Length 2 (bp):1119Length divergence:0
MFE 1 (kcal):-428.44MFE 2 (kcal):-398.3MFE divergence-0.036