Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046849-GRMZM2G152548
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276591
Function (paralog2):hypothetical protein LOC100383611

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.12802445181104
Log2 mRNA fold difference:1.3519388309237
Log2 TE fold difference:-1.2273009269911
Sequences
Protein sequence

MEAAAVAAALRSPTATTAAAAAGPTWRAAAPGAASLAFDRRRSFAFGSIKGLGRQQLTSR
STRRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQL
QTDREADKEKDKESDAGDKLAPTGGDLVLYRRIAEVKEKERRRTLEEILYALVVQKFVEA
GVSLVPALSRSTDPSGRVDQWAETVEEKLQRLHSHEAYEMIENHLTLILGQRQGDATIAA
ISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWGSEEEDSALNQVMMTDLMPSAQ
TSSSHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKH
TEALFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHF
VTS*

MEAAVAAALKSPTAARPSWRPAAPGATSLPFDRRRSFAFGSIKGLGRQQLTSRTRRRSSV
VRASWSPSESLPPSSSMAPLRMESPAGQLLSQILHTHPHLLPAAAEQQLELLQTDREAEK
NKDKESDAGDKLAPTGVDLVLYRRIAQVKEKERRRTLEEILYALVVEKFVEAGVSLVPAL
SRSIDSSGRVDQWAETVEGRLQRLHSPEAYEMIENHLALILGQRQSDATIAAISKLRVGQ
VYAASVMYGYFLKRVDQRFQLEKTMKSLPWGSEEEDGALYQVMTTDSMPSAQSSSSHPEM
GSWTAAPDFNAGGPSESIKPCRLRSYVMSFDPDTLQRYATVRSKEAFGIIEKHTEALFGK
AEIVVTPGGTVGSSKDEHIRISFAGLRRLVLEAVTFGSFLWDVESFVDSSYHFVTS*

Other information
Ka divergence:0.111404KaKs divergence:0.0691477
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):1272Length 2 (bp):1251Length divergence:-0.008
MFE 1 (kcal):-498.2MFE 2 (kcal):-479.4MFE divergence-0.019