Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046885-GRMZM2G370777
Species:maize
Duplication type:WGD
Function (paralog1):m26 protein
Function (paralog2):m19 protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9127724438735
Log2 mRNA fold difference:1.9584223391358
Log2 TE fold difference:-0.049901448194751
Sequences
Protein sequence

MARERREIKRIESAAARQVTFSKRRRGLFKKAQELSVLCDADVALIVFSSTGKLSQFASS
SMNEIIDKYNTHSKNLGKTEQPSLDLNLEHSKYANLNEQLAEASLRLRQMRGEELEGLNV
EELQQLEKNLESGLHRVLQTKDQQFLEQINDLERKSTQLAEENMQLRNQVSQIPPAGKQA
VADTENVIAEEGQSSESVMTALHSGSSQDNDDGSDVSLKLGLPCVAWK*

MARERREIKRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSQFASS
SMNEIIDKYSTHSKNLGKAEQPSLDLNLEHSKYANLNEQLVEASLRLRQMRGEELEGLSV
EELQQLEKNLESGLHRVLQTKDQQFLEQISDLEQKSTQLAEENRQLRNQVSHIPPVGKQS
VADAENVIAEDGQSSESVMTALHSGSSQDNDDGCLVLHGSEKTRWSVLIWVELRLQQIGT
CVIVLWTTPDYCNNLASEARSVNLICHPCGFMMRCCACTVC*

Other information
Ka divergence:0.208759KaKs divergence:0.174101
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):687Length 2 (bp):846Length divergence:0.104
MFE 1 (kcal):-231.6MFE 2 (kcal):-286.9MFE divergence0.107