Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046911-GRMZM2G438299
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276723
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.077023291897292
Log2 mRNA fold difference:0.18798670084999
Log2 TE fold difference:-0.45008618730906
Sequences
Protein sequence

MDLASSDLAALGAAELVRVSASIPRAAPRTFALLTACLVFPLSFAVLAHSLFTHPILLRI
QGATHSELAQWLRLFAYQFLYLIVLFTFSLLSTAAAVFTVASLYANKPASISSSLTALPP
ILPRLLRTFLWVSLLMLAYHLVFALTVLLLIVVFIPNASESESAPPSLAFVLFLVVVVFV
FLGIHVYISALWHLASVISVLEPLCGLAAMAKSKDLLQGRTGTAATLVVSYFAVCGVTSV
LFRAAVVKGRAEEGSFGLALPGRLLVGAVLLCVLVCVNLLGLLVQSVFYYACKAFHNQQI
DRTALYEHLGGYLGEYVPLKSNIQMENL*

MDLASSDLAALGAAELIRVSASIPRAAPRTFALLTACLVFPLSFAVLAHSLFTHPILLRI
RGAAHSGFAPWLGLFAYQFIYLIVLFTFSLLSTAAAVFTVASLYTGKPASVSSSLSALRP
ILPRLLRTFLWVSLLMLAYHLAFALAVLLLIVVFAPNASESAPPSLAFVLFLLLVVLVFL
GIHVYISALWHLASVVSVLEPLCGLAAMAKSRQLLQGRTGTAATLVVSYFAVCGATSLLF
RAAVVKGRTEEGSFGLALPGRLLVGAVLVCVLVSVNLLGLLVQSVFYYACKAFHSQQIDR
TALYEHLGGYLGEYVPLKSNIQMENL*

Other information
Ka divergence:0.73199KaKs divergence:0.516324
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):987Length 2 (bp):981Length divergence:-0.003
MFE 1 (kcal):-355.54MFE 2 (kcal):-361.6MFE divergence0.008