Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046916-GRMZM2G122841
Species:maize
Duplication type:TD
Function (paralog1):LOC100282048
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.55124481478767
Log2 mRNA fold difference:0.95077316363471
Log2 TE fold difference:-1.5137376133737
Sequences
Protein sequence

MDLLKRELEKKRKAATADFGGKSFVRRSELEQKQLQKRRDEHRQLLAKSGGTSAPSANSA
AAATGSDPSSFDAAAQTAAANPNPSSSAAATSSAPSVPPALAPKKTAQEEALLSEERRID
ELDLPRHEVVRRLRVLREPVTLFGEDDDARLARFKLVLKSGVIDDIDDIDMTEGQTNDFL
RDMIEMRKRQKSGRDTYAKGKSKRVGGGDGGDGGAAGDSADDGDAKGSGDDADADKDSKR
MRTKFEELCNEDKILVFFKKLLNEWNQELDEMTELEKRTAKGKSMVATFKQCARYLSPLF
EFCRKKVLPDDIRRALLVIVECCMKRDYLAAMDQYIKLAIGNAPWPIGVTMVGIHERSAR
EKIYTNSVAHIMNDETTRKYLQSIKRLMTLSQRRYPALPSKSVEFNSLANGSDLQALLSE
ENGSGKASEERLRLMPALKE*

MKRDYLAAMDQYIKLAIGNAPWPIGVTMVGIHERSAREKIYTNSVAHIMNDETTRKYLQS
IKRLMTLCQRRYPALPSKSVEFNSLANGSDLQALLSEENGSGKASEERLRLMPASKE*

Other information
Ka divergence:-1KaKs divergence:-0.999424
GC content 1 (%):59GC content 2 (%):51GC content divergence:-0.073
Length 1 (bp):1323Length 2 (bp):354Length divergence:-0.578
MFE 1 (kcal):-554.9MFE 2 (kcal):-105.3MFE divergence-0.681