Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046924-GRMZM2G140885
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217184
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.21464045009709
Log2 mRNA fold difference:-1.4190461252983
Log2 TE fold difference:1.2023942341296
Sequences
Protein sequence

MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF
VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT
TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV
WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE
YDSSIGVAEGAPPELTSPNPAQ*

MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHRDAF
VAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT
IIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAAGSLVRQNTRIPCGEV
WGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKIEFEKVLRKKFAHQDE
EYDSSIGITRGSPPELTSPNPAQ*

Other information
Ka divergence:-0.097525KaKs divergence:-0.148853
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):789Length 2 (bp):792Length divergence:0.002
MFE 1 (kcal):-277.8MFE 2 (kcal):-304.2MFE divergence0.045