Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046932-GRMZM2G057491
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383320
Function (paralog2):glutamyl-tRNA synthetase, cytoplasmic

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.94671729952648
Log2 mRNA fold difference:-1.3021518736362
Log2 TE fold difference:0.36678883558552
Sequences
Protein sequence

MEAALSFSKDSPPISIICAAKIVGLPLTINHSLAAGSAPTLQFASGESLHGVNPIILYIA
RGASIASLSGKNDIEFGHVVEWLEYAPTFLSGSEFENACLFVDGFLASRTFLVGHGLTIA
DIAVWSNLAGIGQRWESLRKSKKYQNLVRWFNSIDSEYKEALNEVVAAFVGKRGIGKSPA
PSLKEKVHDSKDPSAPEVDLPGAKVGKVCVRFAPEPSGYLHIGHAKAALLNKYFAERYQG
RLIVRFDDTNPSKESNEFVENLLKDIETLGIKYDAVTYTSDYFPKLMEMAESLIKQGKAY
IDDTPKEQMRKERMDGIESRCRNNTVEENLSLWKEMVNGTERGMQCCVRGKLDMQDPNKS
LRDPVYYRCNTDPHHRVGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRIL
QDMGLRRVEIYEFSRLNMVYTLLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKVDA
LIQFILQQGASKNLNLMEWDKLWTINKKIIDPVCARHTAVLKDQRVIFTLTNGPEEPFVR
ILPRHKKFEGAGKKATTFANRIWLDYADAAAISKGEEVTLMDWGNAIVKEIKVESGVITE
LVGELHLEGSVKTTKLKITWLADIEELVPLSLVEFDYLISKKKLEEDEDFLDNLNPCTRR
EIPALGDANMRNIKRGEVIQLERKGYYRCDAPFIRSSKPVVLFAIPDGRQQASLS*

MEATLAFSQDSPPISIICAAKFVGLPLTIDPSLASGLAPTLRFASGESLHGVNPILLYIA
SGATIPCFSGKNDIEFGHVVEWLEYVPIFLSGSEFENACLFVDGFLASRTFLVGHGLTIA
DIVVWSNLAGIGQRWESLRKSKKYQNLVRWFNSIDSEYSDTLNEVLAAYVGKRGIGKSPA
PSLKEKVHVSKDPSAPEVDLPGAKVGKVCVRFAPEPSGYLHIGHAKAGLLNKYFAERYQG
RLIVRFDDTNPSKESNEFVENVLKDIETLGIKYDAVTYTSDYFPKLMEMAGSLIKQGKAY
IDDTPKEQMRKERMDGIESRCRNSTVEENLSLWNEMVNGTERGMQCCVRGKLDMQDPNKS
LRDPVYYRCNIDPHHRVGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRIL
QDMGLRRVEIYEFSRLNMVYTLLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKIEA
LIQFILQQGASKNLNLMEWDKLWTINKKIIDPLCARHTAVLKDQRVIFTLTNGPEKPFVR
ILPRHKKFVGAGKKATTFANRIWLDYADAAAISKGEEVTLMDWGNAIVKEIKVESGVITE
LVGELHLEGSVKTTKLKITWLADIEELVPLSLVEFDYLISKKKLEEDDDFLENLNPCTRR
ENPALGDANMMNLKRGEIIQLERKGYYRCDAPFIRSLKPVVLFAIPDGRQQALLN*

Other information
Ka divergence:0.217443KaKs divergence:0.321328
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2148Length 2 (bp):2148Length divergence:0
MFE 1 (kcal):-662.9MFE 2 (kcal):-646.6MFE divergence-0.012