Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G046968-GRMZM2G028492
Species:maize
Duplication type:WGD
Function (paralog1):zinc finger C-x8-C-x5-C-x3-H type family protein
Function (paralog2):zinc finger C-x8-C-x5-C-x3-H type family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MMGSRRYKRVSWANGANLCKVRLFLSEDSPSQAGLRPQDNLQAKGSWLMHAAGPSSDDSL
PPGFESLQPTSDLKIDMSQIALIRWRCPPQILYNPDWCVAAGEESEEVALQNERMFGALE
AIYPRPSNIPPNPLVTPDVKDSQYDDSRTQLVPLLPVEEDDASDQFEEPPVGLPSSYHQS
DKYDDAISRVPQASDALFTTAQQQPNGSINTTRSGVPAEADVVAAASAAYTAIMQSNQMG
NMIDQDLLIKILSDPAQIQRLMKEYGALKHEQSTNSSVASMVQGPPPQMTASVPVSIPDR
SNAFHNINPKLPPPPVPNRLPPASVTMNAPASSSQAISFPSGPTRGLNYYQNLIHQHGGE
RQEPLQQHGMQFAMHHQPLASQASAADVVSSGAMPARDTKQRPTKPCAYFNSARGCRNGA
NCTFLHDVSAARKEQSKGSKRIKLDSRIAGRY*

MGPRRSKRVSWATGANLCKVRFFISEDSPSQAGLRPQDNLQAKGSWLMHAAGPSSDDSLP
PGFESLQPTSCLKIDISQIHVIRWRCPPKVLHNPVWLVAAGEESEEVALQNDRIFGALEA
IYPRPSNIPPNPFVTPDVKDSQYDDSRTQLVPLLPVEEDDASDQLEEPPVGLSSSYQQSD
KYDSATFRVPQASDAPFTTAQQQQPNGSINTTRSGAPVEPDTVAAASAAYTAIIQSNRMG
NMIDKDLLVEMLSDPAQLERLMKEYGALKHEQSTNSSVAPMVQGPPPQMTASVPVSFPDH
TTTFHNINSTLPPPPVLNRLPPPAIPSAVTINPPASSSQAISFPTGRTSGLNYYQTLIHQ
HGGERQEPQPLQQHGMHFPMHHRTVASQSSATDIVSSGTMPARDTKQRPTRPCAYFNSAR
GCRNGANCTFLHDVSAARKEQPKGSKRIKLDSRIAGRY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):1359Length 2 (bp):1377Length divergence:0.007
MFE 1 (kcal):-431.59MFE 2 (kcal):-440.43MFE divergence0.01