Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047019-GRMZM2G123328
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272282
Function (paralog2):hypothetical protein LOC100193030

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.91939213578955
Log2 mRNA fold difference:-1.4157341870583
Log2 TE fold difference:0.51131398995665
Sequences
Protein sequence

MAALPPAAEDPDAVEIREVWASNLEEEFAVIRAVVDVYPYVAMDTEFPGFVVTPSAEYRF
TCDRNYAALEGNVNVLKLIQLGLTLSNGAGALPPCGTGGRRCIWQFNFRGFDPHTDPSSS
DSIDLLRRSGIDFDLFAAEGVDSTRFAELMMSSGVVLNDDVQWVTFHSGHDFGYLLKLLT
GREMPNTLDEFLKLTKTFFPVMYDIKHLMKFCGGGLYGGLSKLGELLKIERVGISHQAGS
DSLLTLQCFMKLKQLYLKESVKLYDGVLFGLIPGEVEIKPVAPPIE*

MDAPAPAVEIREVWASNLEEEFEVIRDVVDAYPYVGMDTEFPGFVVQPIAEYRFTCDRIY
AGLEGNVNVLKLIQLGLTFSNEAGTLPPCGTGGQCCIWQFNFRGFNPHTDPYSPDSIDLL
RRSGIDFDLFAVEGVDSTRFAELMMSSGIVLNDDVQWVTFHGSHDFGYLLRLLTGREMPN
TLDEFLKLTKIFFPVMYDVKHLMKFCGPGLYGGLSRLGKLLKVERVGTGHQAGSDCLLTL
QCFMKLKQLYLKESVKLYDGLLFGLIPGEVEIKTAPPPIG*

Other information
Ka divergence:0.324842KaKs divergence:0.655866
GC content 1 (%):59GC content 2 (%):58GC content divergence:-0.009
Length 1 (bp):861Length 2 (bp):843Length divergence:-0.011
MFE 1 (kcal):-364.7MFE 2 (kcal):-371.69MFE divergence0.009