Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047038-GRMZM5G878347
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100304307

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEAKPSSAAHGDAPAVEAPRRRGSGGKRKSAGSSFTPSKRQAKERNAAFHVPQHLLHSGP
LTRAARHSPHKLAGTPPESGPASSSAATGDGVSGGQAEVDAIRPETEETPAPELPLVDEM
LEAVRSRGPGVHVVPTFAGWFSWKEIHSVEKQILPSFFNGKSVKRTPEVYLAIRNSIMMK
FHANPQLQLESKDLAELSIGESDARQEVLEFLDHWGLINFHPFPPAGHEESKPEESQDNS
NDEKASLIEQLFKFESVQSYMTPLLNKEDVGAPPPLPSLFPEPVLIENMVAAAEPSVEYH
CNSCSVDCSRKRYHCRTQADFDLCCVCYNEGKFDPGMAKTDFILMDSAEVSGASGTSWTD
EETLLLLEGLEIFGGKWAEIAEHVATKTKAQCMLHFLQMQIEDRFHDGDDINQNIPVSTE
QATTEKAIVETPEKMEVGDKVEGRDNADEKASEKTEGSCEETKTEDANVVNKDTQKSGGK
DSGASPSTEEAKQSSDDQPIVKENSVDVDTSGEKLSNVAIDILKCAFEAAGHSPEYEGSF
ADAGNPVIALAAYLAGLVEDGNATTSFRSSLKSISEVPPALQLASRHCFILEDPPNELKD
ICVSVSKKNTDADQTKDEDMISNSIANEKKEINEKEDKSLSVEKTNNSSMSQNDHQESNI
KSVSRDDCSSVEPKGNNAKESSDSTGIGDMSAIGTTKDVVAGNSKQVNDSPSVEVEAPDD
SSLKSKDELNDTEDAVATPATVQEQKHSQTLENGDKAEPNNIERVVVHEKGSIVTANQND
SITRLKRAAATAVSAAAVKAKFLGDQEEYHIRRLTALMIEKLFQKLEVKMSLFSEIEQVV
LRTREYTEKTRKKLLMERNAIIAARMGALPSRPNQPGVAGNRLPPGYGNPPLRSPNAMPR
PSS*

MLQQAGRFESLGYASKRMGYRSLGVRNPEFPQLVGRGIAFGGLTGGLPYPGGNLFPATPV
WFGLDGNAPIRAAIIAFRSFRSFFLVFSVYSLVRKTTCSISENNDIFTSIFWNSFSITSA
VSLRI*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):2712Length 2 (bp):378Length divergence:-0.755
MFE 1 (kcal):-880.33MFE 2 (kcal):-125.1MFE divergence-0.751