Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047055-GRMZM2G152328
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284092
Function (paralog2):LOC100284092

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.2116418708245
Log2 mRNA fold difference:-3.5854416028953
Log2 TE fold difference:0.66884651920775
Sequences
Protein sequence

MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEK
SYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNKR
SSGQKIKKTHSDFPKSDLYLLTILLPSADVDCQG*

MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLAYIALDYDQEMETAKTSSSVEK
SYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF*

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:0.980654
GC content 1 (%):57GC content 2 (%):60GC content divergence:0.026
Length 1 (bp):1185Length 2 (bp):1134Length divergence:-0.022
MFE 1 (kcal):-438.77MFE 2 (kcal):-454.5MFE divergence0.018