Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047238-GRMZM2G144367
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282939
Function (paralog2):stromal cell-derived factor 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.339362065711
Log2 mRNA fold difference:1.5000887787424
Log2 TE fold difference:-0.16223068766906
Sequences
Protein sequence

MAASLLVLAVAFLVGAGHGGIDGGAAAHMEVEGSEVTYGSVIKLLHEKTKHRLHSHDVPY
GSGSGQQSVTGFPEGDDSNSYWIIKPTPDSSSKQGDSIQTGGIIKLQHMKTRRWLHSHLH
ASPLSGNLEVSCFGGDELSDTGDYWRLEIEGSGKVWKRDQKVRLRHVDTGGYLHSHSKKY
NRLGGGQQEVCGVREKRAENIWLAAEGVYLPVNGSK*

MAASLLVLAVAFLVGSGSGGIDGGAAAPVEVEGTEVAYGSVIKLMHEKTKHRLHSHDVPY
GSGSGQQSVTGFPEGDDSNSYWIIRPTPDSSSKQGDAIETGGIIRLQHMRTRRWLHSHLH
ASPLSGNLEVSCFGGDELSDSGDHWRLEIEGSGKVWKRDQKVRLRHVDTGGYLHSHNKKY
NRLGGGQQEVCGVREKRAENIWLTAEGVYLPVNGSK*

Other information
Ka divergence:-0.120462KaKs divergence:-0.365559
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):651Length 2 (bp):651Length divergence:0
MFE 1 (kcal):-224.3MFE 2 (kcal):-243.2MFE divergence0.04