Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047310-GRMZM2G180988
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273789
Function (paralog2):hypothetical protein LOC100279855

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.75520874807018
Log2 mRNA fold difference:1.0988395861604
Log2 TE fold difference:-0.36041878609577
Sequences
Protein sequence

MSTAKVLDPAFQGAGQKVGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTCTKGGAY
LYDIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPL
EGGFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDTENKIYQFNG
ANSNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKT
VSDDDVVLETTAPKLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQME
DRKSATKAVDEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNAAGNPGTEEGRGK
VAALLKQQRVDPKGAAKSTTPVNEEVPPLLDGGGKLEVWCVDGNTKTALPKEDIGKFYSG
DCYIILYTHHSGDKKEEYYLSYWIGKDSLVDDQVSASQIINTMWNSLKGRPVLGRIYQGK
EPPQFVALFQPMVILKGGIGSGYKKLIEEKGAMGETYTTEGIALIRVSETSIYNNKTLQV
DAVATSLSSTESFVLQSGNAMFTWFGNSSTYEQQQWAAKVAEFLKPGVAVKHCKEGTESS
AFWFALGGKQSYTNKNTPQDIITREPHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMVLD
THGEVFIWIGQYVESKEKQKAFDIGQKYVEHANSIEDLSPHVPLYKVMEGNEPCFFKTYF
SWDNTKSLVHGNSFQKKLSLLFGLRSEGAPRSSGNGGPTQRASALAALSSAFNPSSQQRL
SNERPKSTGDGPTQRASALAALSNAFNPSLKPKTSPPSRSGRGSQRAAAVAALSSVLTAE
QSGSSEFLRSKASNTAYKTDVDRIVITPAGPSGPSSPQSEAGESNVFHQEKDAAADGAPP
DTDGAVAEAGEEETTENVGEATFSYDRLISKSTDPVRGIDYKRREAYLSDSEFQTVFGMT
KDAFYRQPNWKQELQKRKADLF*

MSTAKVLDPAFQGAGQKVGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTTCTKGGAY
LYDIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPL
EGGFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDAENKIYQFNG
ANSNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKT
VSDDDVVLETTAPRLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQME
DRKSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNATGSPGAEEGRGK
VAALLKQQGVDLKGAAKSTTPVNEEVPPLLEGGGKLEVWCVDGNAKTALPKEDIGKFYSG
DCYIILYTYHSGDKKEEYYLSYWIGKDSLVDDQVSASQITNTVWNSLKGRPVLGRIYQGK
EPPQFVALFQPMIILKGGIGSGYKKLIEEKGATGETYTTEGIALIRVSGTSIHNNKTLQV
DTVATSLSSMECFILQSGNAMFTWFGNSSTYEQQQWAAKVAEFLKPGVAVKHCKEGTESS
GFWFALGGKQSYTNKNAPQDIITREPHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMILD
THGEVFIWIGQCVESKEKQKAFDIGQKYVEHANSIDDLSPYAPLYKVMEGNEPCFFKTYF
SWDNTKSLVHGNSFQKKLSLLFGLRSEGASRSSGNGGPTQRASALAALSSAFNPSSQQRL
SNERPKSTGDGPTQRASALAALSNAFNSSLKPKTPPPSRSGQGSQRAAAVAALSSVLTAE
QSGSSENLRAKASSTGDKTDVDRPVITPAGPSGPSSPQSEAGESNVFRQEKDAAVDGAPS
DTDGAVAETREEETTENVGEATFSYDRLISKSTDPVRGIDYKRREAYLSDSEFQSVFGMT
KDAFYRQPNWKQELQKRKADLF*

Other information
Ka divergence:-0.156945KaKs divergence:0.169867
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2949Length 2 (bp):2949Length divergence:0
MFE 1 (kcal):-926.58MFE 2 (kcal):-947.84MFE divergence0.011