Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047376-GRMZM2G104076
Species:maize
Duplication type:TD
Function (paralog1):protein phosphatase type-2C
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.22450248190078
Log2 mRNA fold difference:-0.015212292556578
Log2 TE fold difference:-0.20847336227906
Sequences
Protein sequence

MVIYLSTPKTDKVSEDGENDKLKFGLSSMQGWRATMEDAHSALLDLDNDTASFGVFDGHG
GKVVAKFCAKYLHIEVLHTEAYAAGDLGAAVHRAYLRMDEMMRGQRGWQELQALGDKINQ
FTGITEGLIWSPKASDSNDRHDDWAFEEGPHSDFTGPNCGSTACVALVRNRQLVVANAGD
SRCVISRNGQAYNLSRDHKPELEAERERIQSAGGYIKMGHVNGSLNLSRAIGDMELKQNK
FLSPDKQILTANPDINIVELCDDDEFIVLACDGIWDCMSSQQLVDFIREHINTEESLSAV
CEGVLDRCLAPSTMGGEGCDNMTMILVQFKKPFAQVKDASDAEQLTGDAGCSETHGAEEN
DSDKQI*

MLVGFTQSPLRCFLCQVQSLTILPFTPLSLPLFPVGDALARSSAARSAATSASVCQVFVV
RFAVDWCPAGTSGRMGVYLSTPKTDKVSEDGENDKLKFGLSSMQGWRATMEDAHSALLDL
DNDTAFFGVFDGHGGKVVAKFCAKYLHREVLHTEAYAAGDLGAAVHRAYLRMDEMMRGQR
GWRELQALGDKINQFTGIIEGLIWSPKASDSNDRHDDWAFEEGPHSDFTGPNCGSTACVA
LVRNRQLVVANAGDSRCVISRNGQAYNLSRDHKPELEAERERIQSAGGYIKMGRVNGSLN
LSRAIGDMELKQNKFLSPDKQILTANPDINIVELCDDDEFIVLACDGIWDCMSSQQLVDF
IREHINTEESLSAVCERVLDRCLAPSTAGEGCDNMTMILVQFKKPFAQVKDASGAEQLTG
DAGCSETQ*

Other information
Ka divergence:-0.645634KaKs divergence:-0.274691
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1101Length 2 (bp):1287Length divergence:0.078
MFE 1 (kcal):-331.78MFE 2 (kcal):-421.11MFE divergence0.119