Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047384-GRMZM2G132303
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191724
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.41335533655612
Log2 mRNA fold difference:0.34653572622996
Log2 TE fold difference:-0.22531937401051
Sequences
Protein sequence

MCNSNVKSAGVAQIDGRPVLQPAGNRVAAPDAARPLKKSLHKSFSMPPSYDNNATVPARP
APAENTRAAPAPPSLLPPTTPAPAPAAARATKAAGAVPAEKPRSKARKPGAVLPVATFAA
PEAFEPAGSIAAARREHAAQAQAQRKSRIAHYGRTASFSRVEGRVGATATAEPAVPASPT
TGLDEKRCSFITPYSDPLYVAYHDEEWGVPVHDDELLFEMLTLSGVQVGADWTSILKKRH
VYREAFSGFDVDAVAKYTEKQMASLSADYGLDLGTVRGTVNNACRILEVRRDFCSLDKYV
WAFVNNKPLSPSYKYSRKIPVKTSKSESISKDMVRRGFRFVGPTVIHSFMEAVGLTNDHL
VSCPRHRVCSAAARVNN*

MCNSNVKSAGVAQIDGRPVLQPAGNRVAAPEPDASRPLKKSLQKSLSMPVYYDSNATAGA
RPAPAENTTRAAANSSPLPPAKAATKAAGAFPAEKSGRSKAARRPGAVPPPVVAFAALEA
LEPAGSIAAAQREHAAQAQAQRKLRIAHYGRTASFSRVEGRVVGAAAAAAERAVPASPTG
HDEKRCSFITPYSDPLYVAYHDEEWGVPVHDDE*

www.000webhost.com

Other information
Ka divergence:0.288739KaKs divergence:0.114876
GC content 1 (%):68GC content 2 (%):73GC content divergence:0.035
Length 1 (bp):1134Length 2 (bp):642Length divergence:-0.277
MFE 1 (kcal):-536.8MFE 2 (kcal):-358.9MFE divergence-0.199