Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047513-GRMZM2G017957
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100283210

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAVPTSTSSPLPLLFLHRCTANSSPSVLSFPSSLRGASLRSRAAAAPPAETLSDDGIPDA
PPEGAGTGIPLPSSIGDDGEQLAPKQKIRIKLRSYWVPLIEDSCKKIIEAAKTTNAKTMG
PVPLPTKRRVYCVLNSPHVHKDSRFHFEIRTHQRLIDIMYPTAQTIDSLMQLQLPAGVDV
EVKL*

MLLPVTMAVHTTTSSSHPLLFLYRGTANPSPAVISLPSSLRGVSLRSRATAAPPAETLSD
DGIPDAPPEGEGTGIPLPSSIGDDGEQLLYGIAGKEIVTRPCAQLVSSHSDSLDVSQEKI
VIINRYGERLVGVLHETGSKELVVLCHGFRSSKEGRTIVSLADALTSENISIFRFDFSGN
GESEGTFEYGNYYKEVDDLRDVILHFKKHKRDTHAIAGHSKGGNVVILYASIYHDISKVV
NLSGRFKLERGIEDRFGNDYMEKIDQHGFIDVEDKTGRIIYRVTKQSLMDRLKTDMHSAC
LSIDPNCRVLTVHGANDDVVPSEDALEFNKYISNHELHIIEKADHRYASHQLELAAVVLK
FIKSK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):44GC content divergence:-0.137
Length 1 (bp):555Length 2 (bp):1098Length divergence:0.328
MFE 1 (kcal):-194.44MFE 2 (kcal):-350.3MFE divergence0.286