Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047607-GRMZM2G007384
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382598
Function (paralog2):hypothetical protein LOC100383949

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSASKSKSKDRSAAKVAKEQPKVSAKPLGNGTLASSYNNLSGKFHVLEPSASLLGSQGI
NKFRNTDEIDEHSRSSHGTGDFDCASNNGSCSDESEDPKEKPTSSVSRVESVPGCDIDKR
EKIRQKNEKKHQRQKERRAQELHERCKGYLMSRKLEALAQKLVAMGFSADQATMALIQNE
GCVEESVTWLCNFDGSEEAKQQLAADQQSGVNLKIDIADELSKIVSLEVKYKCTKQEVER
AVVSCEGDLERADEALKTHKQESTAVPPKPEGSSDSSALPNKQQVVLAQNPARAQTNGFS
SVGSQQTRREEEISYKLLMNGSGPKDPAIKGFQPMAAPTKPDLGRQQFVQPEKRRLNPNS
IPSIPYVASSPLPVAVPQLKSDMRHVAGTNEVKSSMPNGSLRESVIVMQRPQSAGTKQSL
PSTSHSMFASEPSARDWYLNGASGVNMMLNGGLGHGLRNMSLDSVSSGRSFGHANHQQSF
VSNPIELAANGWGGTWSSGGTSSSRPVVSSFGAFRGWSSSESSPALPHSDWRANGAAPYD
YTSVDWSLDTTLLNPAAKSERLSDTWSTMFMGGRSTRTPGNLSGAGIAGLHDSNHPMDPA
PSPRPYEWPTFCRGGSS*

MPSASKSKAKERSAAKVAKEQPKVAAKPMGNATLASSYNNLSGKFHVLEPSSSLLGSQGI
DKFRNTDEIDEHSRSSHGTGDFDCASNNGSCSGDSEDTKEKSTSTASRVDSVPGCDIDKR
EKIRQKNEKKHQRQKERRAQELHERCKGYIMSRKLEALAQKLVAMGFSADQATMALIQNE
GCVEESVTWLCNFDASEEAKQQLVADQQSGVNLKIDIADELSKIVSLEAKYKCTKQEVER
AVVSCEGDLERAEEALKTHKQESTAIPPKPEGSGYSSGLPNKPQVVLAQNPARPQTNGLS
SVGSHQMRREEKDINYKLLMNGSGPKEPAIKGFQPLATPIKPDLVRQQFVQPEKRRLNPN
SNPSVPSVASSPLPVAVPQVKPDMRHVAGTNEVKSLMPNGSLRESVIVMQRPQSAGTKQS
LPSTSHSMFVSEPSARDWYLNGVSGVDMMLNGGLGHGLRNMSLDSASSARSFGHANHQQN
LVSNPIELAANGWGGTWSSGGTSSSRSVVSSLGAFRGWNASESSALPHSDWRTNGAAPYD
YTSVDWSVDTTLLNPAAKSELLSDTWSTMFMGGRSTRTPGNLSGAGIAGLYDSNRPMDPA
PSARPYEWPTFCRGGSS*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1854Length 2 (bp):1854Length divergence:0
MFE 1 (kcal):-614.3MFE 2 (kcal):-610.61MFE divergence-0.003