Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047774-GRMZM2G014170
Species:maize
Duplication type:WGD
Function (paralog1):AKINbetagamma-1 protein kinase
Function (paralog2):protein kinase AKINbetagamma-2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFSHGADSAHDAGTVGVSSGVGATVPARFVWPYGGKRVFVSGSFTRWSEHLPMSPVEGCP
TVFQAICSLSPGIHEYKFYVDGEWRHDERQPTISGEFGIVNTLYLTREFNQINALLNPST
PGSRMNMDVDNENFQHTVTLSDGTIPEGTVRVSEAAIQISRCRVSEYLNLHTCYDLLPDS
GKVIALDINLPVKQSFHILHEQGIPVAPLWDSFRGQFVGLLSPLDFILILRELETHGSNL
TEDQLETHTISAWKEAKRQTCGRNDGQWRAHQHLVHATPYESLRDIAVKLLQNDISTVPV
IYSSSSDGSFPQLLHLASLSGILKCIFRYFKNSTGNLPILNQPVCSIPLGSWVPKIGDPN
SRPLAMLRPNASLSSALNMLVQAGVSSIPIVDENDSLLDTYSRSDITALAKDKVYTHVRL
DEMTIHQALQLGQDANTPFGFFNGQRCQMCLRSDPLLKVMERLANPGVRRVFIVEAGSKR
VEGIISLSDIFKFLLSL*

MFSHGADSAHDAGAVGVSSGGATVPTRFVWPYGGKRVFVSGSFTRWSEHLPMSPIEGCPT
VFQAICSLSPGIHEYKFFVDGEWRHDERQPTISGEFGIVNTLYLTREYNQINTLSSPSTP
GSRMNMDVDNENFQRTVTLSDGTVSEGTLRVSEAAIQISRCRVSEYLSLHTCYDLLPDSG
KVIALDINLPVKQSFHILHEQGIPVAPLWDSFRGQFVGLLSPLDFILILRELETHGSNLT
EEQLETHTISAWKEAKRQTNGRNDGQWRPQQHLVHATPYESLRDIAVKLLQNGISTVPVI
YSSSSDGSFPQLLHLASLSGILKCICRYFKNSTGNLPILNQPVCSIPLGSWVPKIGDLNS
RPLAMLRPNASLSSALNMLVQAGVSSIPIVDDNDSLLDTYSRSDITALAKDKVYTHVRLD
EMTIHQALQLGQDANTPFGFFNGQRCQMCLRSDPLLKVMERLANPGVRRVFIVEAGSKRV
EGIISLSDIFKFLLSL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1494Length 2 (bp):1491Length divergence:-0.001
MFE 1 (kcal):-485.58MFE 2 (kcal):-487.71MFE divergence0.002