Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047855-GRMZM2G141903
Species:maize
Duplication type:WGD
Function (paralog1):CK2 protein kinase alpha 2
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.32121203293452
Log2 mRNA fold difference:0.13425792552405
Log2 TE fold difference:-0.48525271623958
Sequences
Protein sequence

MIGASPWNRLPSGIAKPAAAAAVVVAALASSFLALPRPRAAPPPAGSGPLMSKAKVYTDV
NVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNYEKCIIKILKPVKK
KKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEFVNNTDFKVLYPTLTDYDIRY
YIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASR
YFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLN
AYLNKYHIELDPQLEALVGRHSRKPWSKFMNADNQHLVSPEAIDFLDKLLRYDHQDRLTA
REAMAHPYFLQVRAVENSRTRPQ*

MIGFPPWNCLPTGIAKIAAAAAVVVAALASSGIALPRPRAAPPPSGFGLLMSKAKVYTDV
NVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKK
KKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEFVNNTDFKVLYPTLTDYDIRY
YIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASR
YFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLN
SYLNKYHIELDPQLEALVGRHSRKPWLKFMNGDNQHLVSPEAIDFLDKLLRYDHQDRLTA
REAMAHPYFLQVRAVENSRTRAQ*

Other information
Ka divergence:0.619661KaKs divergence:0.404984
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1152Length 2 (bp):1152Length divergence:0
MFE 1 (kcal):-355MFE 2 (kcal):-354.4MFE divergence-0.001