Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047889-GRMZM2G302883
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100277078

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.078346913738117
Log2 mRNA fold difference:0.43877382340593
Log2 TE fold difference:-0.27920940697691
Sequences
Protein sequence

MASAAAGAPKRCYYEVLGLSRDCSPTDIKLAFRRLALSLHPDKQPPGSDLALATAAFQEL
QHAHSVLSDPQERAYYDSHRSQIIFSDPASAGAKSASTVPDLFAFFSSSAFSGFSDTGRG
FYKVYGDVFDRVFAQELAYARRMVVPEPAAPPVIGNLDSPYAQVTAFYSYWLGFGSGMDF
GWAAAWDAARGESRRVRRLMEEDNKKAMRKARREYNDAVRGLAAFCKKRDKRVVDMVLKK
KLEEEKRKAEEKERRKEEDKRKKERAMAYQEHEWARAEEGLYDEDEEEEMRAKKELSYCA
ACNKKFKSDKQWKNHEQSKKHRNKIAELRKAFREEESLKKAEEGEGDWNEVDMGFDFKPT
QESDDASAFSDAAEELAEEFESNYAGNGHHGKCEVQPEGSVHVNDVDDIMEGPSSSNVNN
GAVIMVLQLPSPLPVLCCSRRNKLFSHLEETGHAMLKSLVGSAWFS*

MASAAAGAPKRCYYEVLGLSRDCSPTDIKLAFRRLALSLHPDKQPPGSDLALATAAFQEL
QHAHSVLSDPQERAYYDSHRSQIIFSHPASAGAKSASTVPDLFAFFSSSAFSGFSDTGRG
FYKVYGDVFDRVFAQELAYARRMGVPEPAAPPVIGNLDSPYAQVTAFYSYWLGFGSGMDF
GWAAAWDAARGESRRVRRLMEEDNKKAMRKARREYNDAVRGLAAFCKKRDKRVVDMVLKK
KLEEEKRKAEEKERRKEEDKRKKERAMAYQEHEWARAEEGLYDEDEEEEMRAKKELLYCA
ACNKKFKSDKQWKNHEQSKKHRNKIAELRKAFREEESLKKAEEGEGDWNEVDMGFDFKPT
QESDDASAFSDAAEELAEEFESNYAGNGHHGKYEVQPEGSVHVNDVDDIMEGPSSSNVNN
GAVIMVLQLPSPLPVLCCSRRNKLFSHLEETGHAMLKSLVGSAWFS*

Other information
Ka divergence:-0.146789KaKs divergence:0.999701
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):1401Length 2 (bp):1401Length divergence:0
MFE 1 (kcal):-528.41MFE 2 (kcal):-531.08MFE divergence0.003