Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G047961-GRMZM2G094356
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):UPF0497 membrane protein 17 (Vegetative cell wall protein gp1)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.60217533252308
Log2 mRNA fold difference:-1.8991842015929
Log2 TE fold difference:1.4063992957157
Sequences
Protein sequence

MASTPRTPAPDRSPPPPLVTHTMPSTPRTPVSDRSPPPVTHTMPSTPRTPAPDRSPPPVP
TPPPPLETPPPPSPSSQPGDEYHTPPPSLADGSPREEASFPSDGAPKSPQLSPMRLAAPR
LLPPPSPPTPTAQNGQGEEGGAKAAAREPLRLATGLARSPSSQRSLATATNSLSPSPSPT
PPSPLTPAPVVDTSSNNNNNRSGQSTPKRAETKVPLPLPSPAATAAVAVRFDPVEEAVTS
PLHLGKARLDQQQEQHAAAAENAGSSVPPDVAAVAAVGERRELSVTLRLATAVLSLAAFS
VIASARTSGWAGDYYAHHLQYRYAVAVNVIVCAYSIAQSFGEIRRLISPRFIFRSMSSYY
CSLFLDQALAYLLMSASSAAASRNDLWVSRFGTDAFNRKITSALWLSFIAFLMLALNALI
STANLFSMV*

MASTPRTPAPERSPPPVPTPPPPLEDEPPPYLADGSPREEASFSSDGREGAPPKNPQLSP
THHAAPRLVPPPSSPARQDGQEQEGSANKAAAATAEPAREPLRQMATGLARPLSSQTSPA
TTNSPTPSASPTPSSPAPVANNSKRSGQSTPKRAETKLPLSSPAVAVHFDPVEEAVTSPL
RLGKARLDQQQQQQHAAGAAESGASVVPGVAAAVAAVAERRELLLALRLATAVLSLAAFS
VIASARTSGWAGDYYARHLQYRYAVAVNVIVFAYSVAQSLGKIRHLVSPRFTFRTMSSYY
CSLFLDQVLAYLLMSASSAAASRNDLWVSRFGTDAFVRKITGALWLSFVAFLVLALNAVI
STANLFSMV*

Other information
Ka divergence:0.756754KaKs divergence:0.709903
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):1290Length 2 (bp):1110Length divergence:-0.075
MFE 1 (kcal):-600.67MFE 2 (kcal):-551.2MFE divergence-0.043