Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048295-AC206901.3
Species:maize
Duplication type:WGD
Function (paralog1):R2R3MYB-domain protein Fragment
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINY
LRPDIKRGNFSKEEEDAIISLHEQLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLDPTK
QEQQQQHGTTPAAGAGKKHRPAAAAKRGGGGARKATANADAVVVPAPAPATAAPASPERS
AASSSVTESSMTEQEQEHGNTGSSPAFPKEESLTTSSSDAEEFQFDDSFWSETLSMPLDS
LDDVVPMEPSDDDAFGDVDVAAASSSSVGADGDLDYWLRVFMESGDAHPELPQI*

MGRAPCCEKMGLKRGPWTPEEDKILVAHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINY
LRPDIKRGNFSKEEEDAIITLHEQLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEPTT
KQLEQEQHGAHAGGGAARKRSRPKRAGARKTTTAAVAPATTAPASPERSAASSSVTESTE
QEQGNTGTSSPGFPKEESFTSSSEAAEEFQFDDTFWSETLSMPLDSFDDVPMEPCSGAFG
DVAASSSSSSVGADADLDYWLGVFMKSGDAHQQLPQV*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):885Length 2 (bp):834Length divergence:-0.03
MFE 1 (kcal):-433.9MFE 2 (kcal):-404.8MFE divergence-0.035