Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048305-GRMZM2G150266
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381607
Function (paralog2):hypothetical protein LOC100273750

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.1552367265812
Log2 mRNA fold difference:-0.35604122423553
Log2 TE fold difference:0.51514919943004
Sequences
Protein sequence

MEGKTLTPEADTASAPQTLAAGELVWAKPSQPRQHCWWPARMLSACPASAVRDAQVSYFS
DPAASGAPSAPPAQVRRFADADADMMACGSTARGFFGAVAEAQARAVAALRLQLTCACVP
PPPPGEDSSVTGVANLAPAEFLAALREAALDISSVGLLDRARLKSWVFAVGEGWGPHGAQ
HYLRRPLDDLVDKIDLDVPAGEDIDADDWLAEDQHKALERLEETPMQKKRCVTKVMDKLD
TSKNEGKIGSPEHVTSGKRVRKRSKYLSPPYTNLGVVDKIIKQADLPKALVPKAAADGSN
VSPLPGSIVVEDVLLLVRGLGKVPKHRDDFPKDAEEFLRLFRSTTFVHGADYKSCKAHEC
PLMHGSRNVDMDIAVGLISDSHAVLKQASCVSKRGRKKDETGSGGSSIKRKKRENTSSAA
TISTSIPITPAIPIRQVKEEDMRTLMKAGSGPRGIEVDVQNEKGKPSPLEVPISAADPEV
VESGHEEAQANVLAVGNMFPEQSAEENDAANLEATRSETNVQNVTVDVSIRSVQTEAMEL
QSNNPIDVSAQSVVVDVPIGSVSKEATEPETSVHKDKNVQSDVSDVPDRIVSKEPTELET
DNRINENVQSVADMSDRSVLKEATMPDADIRIYENLQSAANLPASSGLSPMREDMSQPVD
GNEEPGDVEVCTVQRSYASLQANLPEMLKKVKTNGTDIIGVNHTLNDECQKNGQPVKKVK
LPAEVANHSCGEGTNGTWLDPANLTPTKKKKPAQHFSNPAAVIVEFVPGATVPSREELLS
TFGKHGYLIESQTDISEATRSACVVFGKSIEAEEAYKNGCQYLLGQFGPPFATLRLDFSP
VKLTVPSPSLASKPPLRDIRKNLEDMISARRSALATSSDGQLNPVPDKLLGEMQGLLANV
DRMLTRPPENAP*

MEAKTLTPEADAAAAPQTLAAGELVWAKPSKPRRHCWWPARMLAACPASATRGAQVSYFS
DPAAPGAPSAPPAQVRRFADADAGADMMARGSTARGFSGAVAEAEARAVAALRAQLACAC
VPPTPPPGEDSSVTGVANLAPAEFLAALREAALDVFSAGLLDRARLKSWVRAVGEGWGPH
GARHYPRRPLHDLVDKIDLDVPAGEDRDADGWLAEDQHKALERPEETPLRHKKRGVTKVL
DAGEDEGKMDSPEHVTSGKRQRKRSKYLLPPYTSLVVVDKIALKPVDLPRALVTEAAEDG
SDMSPLPDSIVVEDVLLLVRRLGEVPRHKDDFPKDAEGFLCLFRSTTFVHGADYESCKAY
ECPLVRGSGKVGMEIVVALASDSHAFLNQGSCVLKRTRKKDEAVSGSPSIKKKREKTSLA
SADIPIAPAIPIRQLKAEDMRTLMKAESGLRGIGLGVKNNKGKPSPLKVPISAADPGAVE
LGHEHAQANVLAVCNTFPEQPAKENDATNLEATRSEMNMQNGTVDVPIRSVQTEAMKLQA
NNPIDVNAQSVAVDVPVGSVSKEATEPETSVHKDKNVQSDVSGVSDRIVSKEPTESETDD
HINENVQSVAADMSSRSVSKEAAMTDADIGIHENTQSAADLPDSSGPSPMHEDMSQPVDG
HKEPGSVEVCIVQQSYASLEAMVPEMLKKANANGAGTIGVNYTLKDEFQKDGQPVEKVKL
PAEVANHSCGGGTNGTWLDPANLTPKKRKKVAQHFSNPAAVIVEFAPGATVPSRQELLST
FGKYGDLIESQTDISETTRSASVVYGKSVEAEEAYRNGCQYLLGQFGPPFATLRLDFSPI
VPSPSPPASKPPLRDIRKNLEDMISSRRSALNKATSSADAQLDPVPDKLLGEMQGLLAKV
DRMLTRPHANAP*

Other information
Ka divergence:0.148424KaKs divergence:-0.336813
GC content 1 (%):52GC content 2 (%):55GC content divergence:0.028
Length 1 (bp):2739Length 2 (bp):2739Length divergence:0
MFE 1 (kcal):-988.78MFE 2 (kcal):-1080.6MFE divergence0.044