Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048313-GRMZM2G122327
Species:maize
Duplication type:TD
Function (paralog1):ferredoxin2
Function (paralog2):Ferredoxin-5, chloroplastic Precursor (Ferredoxin V)(Fd V)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0857625985086
Log2 mRNA fold difference:-1.1415683018754
Log2 TE fold difference:0.049799852144295
Sequences
Protein sequence

MAATALSMSILRAPPPCFSSPLRLRVAVAKPLAAPMRRQLLRAQATYNVKLITPEGEVEL
QVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGWVLT
CAAYPTSDVVIETHKEDDLL*

MATVLSSPRAPAFSFSLRAAPAPTTVAMTRGGGASSRLRAQATYNVKLITPEGEVELQVP
DDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIAAGWVLTCVA
YPTSDVVIETHKEDDLIS*

Other information
Ka divergence:-0.316115KaKs divergence:-0.173722
GC content 1 (%):67GC content 2 (%):69GC content divergence:0.015
Length 1 (bp):423Length 2 (bp):417Length divergence:-0.007
MFE 1 (kcal):-192.73MFE 2 (kcal):-189.5MFE divergence-0.008