Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048324-GRMZM2G123776
Species:maize
Duplication type:TD
Function (paralog1):nucleoredoxin1
Function (paralog2):hypothetical protein LOC100191960

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.8429807222477
Log2 mRNA fold difference:-6.0583810159931
Log2 TE fold difference:2.2239573671789
Sequences
Protein sequence

MAEAAPAAGGGIGDILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPK
LIEVYEKLASQGKSFEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSG
IPHLVILDAKTGEVYTEDGVEFVSEYGVEAYPFTPDRINELKEQEKAEKENQTIQSVLGT
STRDYLISNKGDKVPISELEGKYVGLCFVVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVV
AVSLDSEESSFNESFAKMPWLAIPQGDIKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVA
DIIDDHGFEAWEGFPFSAEKLEILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVS
ELVGKTVLVYFSAKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSE
MPWLAVPWEDERKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPFTEER
LEELQKKLDEMAKGWPQKLKHELHDEHELVLLRRGTYRCDGCNEMGSSWSYRCDECDFDL
HPKCALGEEKMGEEAPAGYVCEGGVCRKA*

MAKAAPAAGGGIADILVTRDRDFLVRNSGEQVKISSIEASPVAIYFSNSWFPPSRWFTPK
LIQVYKQLASEGKSFEVIFAWGDLKEKTFNEYFAKMPWLALPFSDIERREALDIRFKVTD
TPHLVILDAKTGEVYTKDGVRIVSEYGVDAYPFTPDRINELKELEKEEKENQTIQIVLGT
STRDYLISNKGDKVPISELEGKYVGLFFVGVGYPPFIEFIDLLAKIYEKLKEVGEKFEVV
AVSIYSEESSFNESFAKMPWLAIPHGDNKCLTLTRYFGFMSLPTLVLIGPDGKTLNNNVA
EIIIDHGFDVWEGFPFSAEKLDFLAEKVKVKAATQTLESLLISGHLDFVIGKDGVKVPVS
ELVGKTVLLYFSSKWCGPSRGFLPTLVEAYSKIKEKNSDFEVVFISHDRDQRSFDEYFSE
MPWLAVPWEDERTAPLKTTFKARGFPILVVIGPNGKTVSWDATELLVVHGADAFPFTEER
LEELQKKVDEMAKAMGWPKKLKHELHGEHELVLQYRGTDTYACDRCVQMGSSWVYTCDCE
ECDFDLHPKCALRKKGEEEETKSSTAGCYVCKGSDVCIKA*

Other information
Ka divergence:0.681038KaKs divergence:0.403841
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1710Length 2 (bp):1743Length divergence:0.01
MFE 1 (kcal):-621.33MFE 2 (kcal):-601.12MFE divergence-0.017