Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048482-GRMZM2G063875
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281384
Function (paralog2):hypothetical protein LOC100280228

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0113360730749
Log2 mRNA fold difference:-1.0675589925431
Log2 TE fold difference:0.054829587232994
Sequences
Protein sequence

MGESLLTALSMDTATAHHPHQGPSTFLSMDTASHDDFDLFLQPQGPFRRCLHAAAVAPPD
INLPLAADPSPPPLASLDANVDMLDVGLGGSQHYDSDSPAAAGPVSAPAAAATTMVAVSH
TKGSGSSAARKCVKRNVSIWGAWFFFTHYFKPVMSADKAGKAKAATTTGGNGNSATLDAF
LVQHDMENIYMWVFKERPENALGKMQLRSFMNGHSRLGEPQFPFSADKGFVRSHRMQRKH
YRGLSNPQCLHGIEIVRAPNLAGVPEADLKRWMQLTGRDANFSVPTEASDFESWRNLPST
DFELERPATAAPAKSSSHGHHKKLLNGSGLNLSTQPSNHSSGDGMEITATCNKRRKDSSP
TAMEEDCSNSNSDKAQDMDVIHTFEPSWMNDFSGVMRHASGPVTAAKTIYEDSKGYLIIV
SLPFADFQKVKVSWKNTLTNGIVKVSCTSVGRMPLLKRHDRTFRLADPAPEHCPPGEFVR
EIPLPTRIPEDATLEAYCDETGTGLEIIVPKFRVGPEEHEVHVSMRPPSSWCQ*

MLVERFGGEERAAMGESLLTALSMDTTTAHHPHQGPFTFLSMDTASHDHFDLFLPPQGPF
RRCLHAAAVAPPDINLPLTADPSPPPPASHDANVDVLDAGLGGPQHYDSDSPAAAGPVLA
PAAAAATVIAVSHTKGSGSSVARKCVKRNDSIWGAWFFFTHYFKPVMSTDKGGKAKAATT
GGNGNSASATLDAFLVQHDMENMYMWIFKERSENALGKMQLRSFMNGHSRLGDPQFPFSA
DKGFVRSHRMQRKHYRGLSNPQCIHGIEIVRAPNLAGVPESDLKRWMELTGRDANFSIPA
EASDFESWRNLPSTEFELERLAAVVPTKSSSHGHHKRLLNGSGLNLSTQPSNHSSGDAME
IATICNKRRKDSSPSATEEDCSNSNSDKAQDMDVSHTFEPSWMNDFTGVMRHASGPVTAA
KTIYEDSKGYLIIVSLPFSDFQKVKVSWKNTLTNGIVKVSCISVGRMPLLKRHDRTFKLA
DPSPEHCPPGEFVREIPLPTRIPEDATLEAYRDETGTGLEIIVPKYRVGPEEHEVHVSMR
PPSSWCQ*

Other information
Ka divergence:0.197205KaKs divergence:-0.999775
GC content 1 (%):58GC content 2 (%):56GC content divergence:-0.018
Length 1 (bp):1602Length 2 (bp):1644Length divergence:0.013
MFE 1 (kcal):-647.66MFE 2 (kcal):-634.61MFE divergence-0.01