Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048793-GRMZM2G047065
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100278661

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

QRNTSEHSKAHSPLLPEHFTSLSSPPACIQRLVTLQNRDSSRRAMADEESSPSSCLSSEN
EHGLQWSNSPEATSMVLAACPRCFIYVMLPQDDPRCPQCKSPVLLDFLQDNNNSKNNSNN
SSRRSRRG*

MSRSNKKSSRGLDLKLNLSLPATGDSSGRVMADEESSPSSCLSSENEHGLQWSNSPEATS
MVLAACPRCFIYVMLPQDDPWCPQCKSPVLLDFLQDNSNNSNNSSRRSRKG*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):387Length 2 (bp):336Length divergence:-0.071
MFE 1 (kcal):-134.09MFE 2 (kcal):-113.09MFE divergence-0.085