Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G048919-GRMZM2G459052
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276658 (LOC100276658), mRNA
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.7976963647022
Log2 mRNA fold difference:0.19457116181879
Log2 TE fold difference:1.4386832751434
Sequences
Protein sequence

MDSWYAWLSRTGLAPSLAHEYGRLFSRNKLEPRDAPHFDHDLLKSMGIAVAKHRLEILKL
ARKQDAGASSSAASRLGRRATRCLSRCARRLAGGGAWRAASSSVTVVPRICGGEDAVRVG
AVQRKGTGSGTTKKMVLMITDGGVAGGGYGYGLRGRGGARLSSASSQKASLMFHDGYQDE
EEEMGDDEDEDGGAGDGDIKWDSMFQDLKPT*

MDDDWCAWLARTGLAPALAHEYGRLFSRNELEPGDAAHFDHDLLKSMGIAVAKHRLEILK
LAKEQAAASSGSRLARRATRCLSRCVRRLAGGGARRGAPSSVAAVVPRICSGDDAVQVGA
VQRKSTGSAAKKMVLMITDGAAAVAGAGGLSGGGGARLSSAKASLMFHDEECGTEEEEEG
GAGTGNDDIKWDSMFQDLKPT*

Other information
Ka divergence:0.0645571KaKs divergence:0.257661
GC content 1 (%):69GC content 2 (%):72GC content divergence:0.021
Length 1 (bp):636Length 2 (bp):606Length divergence:-0.024
MFE 1 (kcal):-324.12MFE 2 (kcal):-324.7MFE divergence0.001