Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049057-GRMZM2G138896
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273071 (LOC100273071), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.87708627525218
Log2 mRNA fold difference:-1.3927512738569
Log2 TE fold difference:0.74384847936807
Sequences
Protein sequence

MASRAHLPGSPASIAVLILSFFQGSVCGITFTFTNRCGDTVWPGLLSGSGTPPLETTGFA
LAPGQSRSLYAPQGWSGRFWGRSGCAFDASGKGSCATGDCGSGEVECRGAGASPPATLAE
FTLDGDGGKDFYDVSLVDGYNLPMLVQPAAAGCPDTGCLVDLNERCPDELRADGGRACRS
ACEAFGSPEYCCNGAYGNPNTCHPSQYSQLFKSACPKSYSYAYDDATSTFTCNHTDYTIT
FCPESTPSSDRSKHSSRRPSHEQLEDSVWLASLKASGASSMKITSWWSAPTVFRSGLAIA
VATLLGAQIAPDHPVVGLL*

MASRARLPGTPASIAVLILSFFQGSVCGTTFTFSNRCGDTVWPGLLAGSGTPPLETTGFA
LAPGQSRALYAPQGWSGRFWGRSGCDFDAASAKGSCATGDCGSGEVECRGAGASPPATLA
EFTLDGAGGKDFYDVSLVDGYNLPMLVRATAPECPDTGCLVDLNGLCPDELRAAHGRACR
SACEAFGSPEYCCNGAYGNPNTCHPSQYSQLFKSACPNSYSYAYDDATSTFTCNHTDYTI
TFCPKSTPTSDKSEHSSRRPSHEQLEDSVWLASLKASDASALATTSWSASIVLRSALAIA
VATLLAAQLAPDHPMVSLL*

Other information
Ka divergence:-0.049728KaKs divergence:0.125194
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):960Length 2 (bp):960Length divergence:0
MFE 1 (kcal):-436.42MFE 2 (kcal):-435.51MFE divergence-0.001