Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049077-GRMZM2G564586
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275119
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-4.3290393939331
Log2 mRNA fold difference:-3.886336683805
Log2 TE fold difference:-0.3571134874201
Sequences
Protein sequence

MADKISTIVLKVDLECERCYRKIRKVLCKIQDKMNIKTISFDEKSNAVTISGPFDADTVC
NKLCCKAGRVIKAMDVKGKDKDGGKAGKEGGGDKPKDAGKPAAAEKDAGKAGKEGGAKAE
KKEEKAEKKKEEKADKKEGGKGDKEAKPAEKGNKDGKAEAKKVKFAEVPAADAKPGKAMP
PGMTKADLGPLLEKMMAAKAGSEPQPIAPPPGAAQGVAVPSVWPAPAGSVSGYGYGYNPG
YEAPPPPSYYAAGAGGGYGCGCGGYNGYCRCGKPAAPGPGGYYGVPVYDSQGWYYGGGGG
ARQPYYPQQHCCEDPNAGCSVM*

MDLKKVEQRGYTIPIGVLLSDEVDATIAEVAGACKHRALHPHRLLGADELPGYVLILSSE
IPRSAPKFLFFFPGCGSRTPYLVQRLPICCAILQIDDLGGDVAAGVPRPDLVENLADDRH
PAAAPRVWTEAVGEVVDAVFDVLVGDELDVAPDATDQGILLCEEGVDFMERSARLGHTRI
AERGRRGHPVRWIWVRMLAWIWCAELSTIVLKVDLECETCYKKIRKVLRTIQDKMNIETI
SFDEKSNAVTISGPFDSDMVCNRLCCKAGRVIKEMDVKGNEKDAKAKGGGGGDKPKDAAK
PAAEEEGGNSEMKAEKAEKKEGKGDKEDTKSDRAEKGNKDGKAEAETVEFDLDVDGVASA
ADAKPGKAMAMPPGMTKADLGPLLEKMMAPGATQSVVVPSIWPASAGFVSGYYGCNPGYE
APPSYYGAGAGAVYGGYYGVPVYDSQGWYYGGGARQQPYYPHQQQHCCEDPNAGCSVM*

Other information
Ka divergence:0.396643KaKs divergence:0.0733479
GC content 1 (%):68GC content 2 (%):63GC content divergence:-0.038
Length 1 (bp):969Length 2 (bp):1437Length divergence:0.195
MFE 1 (kcal):-478.66MFE 2 (kcal):-657.71MFE divergence0.158