Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049091-GRMZM2G060284
Species:maize
Duplication type:WGD
Function (paralog1):ATP binding protein
Function (paralog2):hypothetical protein LOC100216909

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.63887678669417
Log2 mRNA fold difference:-0.94122325790102
Log2 TE fold difference:0.2959491894033
Sequences
Protein sequence

MAEEAKYLETARADRSVWLMKCPPVVSRAWQAASASASSSDAANANPVVAKVVLSLDLLR
PEERPEERPEEPTLQFKMELAQTNTGNTPKSYSLNMFKDFVPMCVFSESNQGKLSCEGKV
EHKFDMEPHSDNLANYGKLCRERTQKYMVKSRQVQVLDNDHGMSMRPMPGLVGLIPSGSK
EKKKQAPAKPSDVKRTRRDRTEMENIIFKLFERQPNWALKALVQETDQPEQFLKEILNDL
CVYNKRGPNQGTHELKPEYKKSTGDTDAA*

MSRAAAARTMDEEAEYLETARADRSVWLMKCPPVVSRAWQAASASSSDAANANPVVAKVV
LSLDLLRQEERPEEPTLQFKMELAQTNTGNTPKSYSLNMFKDFVPMCVFSESNQGKLSCE
GKVEHKFDMEPHSDNLANYGKLCRERTQKYMVKSRQVQVLDNDHGMSMRPMPGIVGLISS
SSKEKKKQAPVKPSDAKRTRRDRTEMENVIFKLFERQPNWALKALVQETDQPEQFLKEIL
NDLCVYNKRGPNQGTHELKPEYKKSTGDTDTA*

Other information
Ka divergence:1KaKs divergence:0.606437
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):810Length 2 (bp):819Length divergence:0.006
MFE 1 (kcal):-252.25MFE 2 (kcal):-256.29MFE divergence0.008