Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049159-GRMZM2G098784
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216906
Function (paralog2):hypothetical protein LOC100381402

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.43529920870334
Log2 mRNA fold difference:0.56460384743137
Log2 TE fold difference:-0.038810837038638
Sequences
Protein sequence

MGLDNTYGDLSGMFYGGLSYDGYTDHSSASDYFRFADPLPATVPQMAPEACSNPSSTVSR
ANTETDNPEDWEFISDESLDYISRMLMEEDIDEKVSMYQAESAALRAAAKPFYDILGHKF
PPSPDRQLISWSMDSPSESSSSICTQSVASTVTSSSVGGTVDSNRRYDIGLSEQLEAYRG
LCGQASHPLVGTSSDASNAVDVLEDPLITNGQIPEYLFESLPTWDFRRGIEEAQKFLPVN
NKLVIGLEAGGIARPQEARKDVSLNAKKADALKVKKNRQSEDLDVIEGRNIKQSAFCSDE
PDWIEMFDDLLLQTEKKATDLRELMRNEASKNSQVTQTKGPSGPRPRGRKPTKKDVVDLR
TILIHCAQAVAADDRRTANELLKQIRHHSKPNGDGTQRLAHCFADGLEARLAGTGSQLYR
KLIAKRTTASDMLKAYHLYLAACPFKRLSHFLSNQTILSMTKHASKVHIIDFGIYFGFQW
PCLIRRLSKREGGPPVLRITGIDVPQPGFRPTERIEETGQRLAEYAEKLKVPFEYQGIAS
KWETIRVEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIV
NGSYSVPFFITRFREALFHFSALFDMLETTVPRDDAQRALIEREMFGREALNVIACEGSD
RVERPETYKQWQVRNLRAGFVQSPLNQEIVMKAKDKVKDIYHKDFVIDEDSGWLLQGWKG
RIIYAISTWKPKNN*

MGLDNTYGELSGMFYGGLSYDGYADHSSASDYFRFADPLPAVVPQMAAEACSNPSSTVSR
ANTEADNPEDWEFISDESLNYISRMLMEEDIDEKVSMYQAESAALRAAAKPFYDILGHKF
PPSPDRQVMPWPMDSPSESSGSICTQSVASAVTSSSVGGTVDSNRCYDVGHSEQLEAFRG
LCGQSSHPLVGASSDASNAVGELEDILITNGGIPEYLFESLPTWDFRRGIEEAQKSLPVS
DKLVIDLETGGIARPQEARKDVPMNAKKDDVLKAKKNRQSEDLDLMEGRNIKQSAFCSDE
PGWIEMFDDLLRQTEKKATVLRELMRSEASKNSQVTQMKGPSGPRPRGRKPTKNDVVDLR
TILIHCAQAVAADDRRTANELLKQIRHHSKPNGDGTQRLAHCFADGLEARLAGTGSQLYR
KLIAKRTTASDMLKAYHLFLAASPFKRLSHFLSNQTILSLTKNASKVHIIDFGIYFGFQW
PCLIRRLSKREGGPPVLRITGIDVPQPGFRPTERIEETGQRLAEYAEKFKVPFEYQGIAS
KWESIRVEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIV
NGSYSVPFFITRFREALFHFSALFDMLETTVPRDDAQRALIEREMFGREALNVIACEGSD
RVERPETYKQWQVRNLRAGFVQSPLNQEIVMKAMDKVKDIYHKDFVIDEDNGWLLQGWKG
RILYAISTWKPKNN*

Other information
Ka divergence:0.553558KaKs divergence:0.999385
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):2205Length 2 (bp):2205Length divergence:0
MFE 1 (kcal):-729.33MFE 2 (kcal):-747.03MFE divergence0.012