Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049190-GRMZM2G117153
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):glycosyl transferase, group 1 family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.10137514869645
Log2 mRNA fold difference:-0.081479097992442
Log2 TE fold difference:-0.02514675350711
Sequences
Protein sequence

MSQTGEAQVPLLQTQEADAEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDE
VLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSP
GIMVLGALAISKMISVPMVMSYHTHLPAYIPRYNLNWLLEPTWSFIRCLHRSADLTLVPS
VAIAEDFETAKVVPANRIRLWNKGVDSESFHTKYRRHEMRVRLSGGEPEKPLVIHVGRFG
REKNLDFLKRVMERLPGARIAFVGDGPYRSELEKMFTGMPAVFTGMLQGEELSQAYASGD
VFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRK
IEQLLSSKDLRETIGMAAREEMEKCDWRTASKKIRNEHYSTAISYWRKKMGKTNQTSLFQ
DSSVAALSN*

MSQTGEVQVPLLQTEEADGEWSSKPRRIALFVEPSPFAYISGYKNRFQNFIKHLREMGDE
VLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSEVNKFKPDIIHATSP
GIMVLGALAIAKMISVPILMSYHTHLPAYIPRYNLNWLLEPTWSFIRCLHRSADLTLVPS
LAIAEDFETAKVVPANRIRLWNKGVDSESFHTKYRRHEMRVRLSGGEPEKPLVIHVGRFG
REKNLDFLKRVMERLPGARIAFVGDGPYRAELEKMFMGMPAVFTGMLQGEELSQAYASAD
VFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRK
IEQVLSSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYSTAISYWRKKMDKSN*

Other information
Ka divergence:0.0063597KaKs divergence:-0.156951
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1290Length 2 (bp):1245Length divergence:-0.018
MFE 1 (kcal):-462.69MFE 2 (kcal):-418.71MFE divergence-0.05