Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049211-GRMZM2G067546
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized proteinVacuolar sorting receptor 1 ;

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.3166128110737
Log2 mRNA fold difference:-1.2230210789687
Log2 TE fold difference:-1.0886730049189
Sequences
Protein sequence

MHAGTRPSHRHEYGTLAHPTSHTSPIQRPPASRRTLSASDPRVVVQRLHPSPLSSLHPEH
KQAAADRTRLVSPAASNWSSAGREGSFSRPVDLRCCALVVVKITIRLLDRAILPFAASPH
TSRSKEPKFPARPAGAGGTGIRALPCFYQQLHWPLRFCRRAVHRWGQGSMMRGHTWLALL
VVVVLALADAAAGRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGLVEYPKSN
RKACQSFDISFKPKQAGGRPTFVLVDRGECFFTTKAWNAQNAGAAAVLVVDDKSEPLITM
DNPEEGKEHLENITIPSVLITKKLGESLKKSAENGDMLSVLLDWRESLPHPDERVEYEFW
TNSNDECGPKCDMQMDFVKSFRGTAQILEKKGYTQFTPHYITWYCPEAFVDSKQCKSQCI
NHGRYCAPDPEQDFSQGYDGRNVVVQNLHQICVFKIANETGKPWLWWDYVHDFALRCPMK
DKKYNHDCASDVIKSLGLDIEKINKCVGDPEANEENVILKAEQDAQIGHGKRGDVTILPT
LVINNRQYRGKLDKVAVLKAICSGFEETTEPAVCLSEEVQTNECLENNGGCWLDKANNVT
ACKVQF

MMRGQAWLALLVVVALALADAAAGRFVVEKNSLEVTSPDELKGKYECAIGNFGVPQYGGT
LHGWVEYPKSNRKACQSFDQFDISFKPKQAGGRPIFVLVDRGECFFTTKAWNAQNAGAAA
VLVVDDKSEPLITMDNPEEGKEHLENITIPSVLITKKLGENLKKSAENGDMLSVLLDWRE
SLPHPDERVEYEFWTNSNDECGPKCDMQMDFVRSFRGTAQILEKKGYTQFTPHYITWYCP
EAFVDSKQCKSQCINHGRYCAPDPDQDFSQGYDGRNVVVQNLHQICVFKIANETGKPWLW
WDYVHDFALRCPMKDKKYNNDCAHDVIKSLGLDIENINKCVGDPEADVENEILKAEQDAQ
IGHGKRGDVTILPTLVINNKQYRGKLDKVAVLKAICSGFEETTEPAICLSEEIQTNECLE
NNGGCWLDKANNVTACKDTFRGRVCECPIVRGVKFVGDGYTHCEASGVGRCEISNGGCWQ
ETKDGKTISACSNEISEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYE
CSCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDS
EIRAIMAQYMPLDNQEGANQHQVVHANDI*

Other information
Ka divergence:0.0144755KaKs divergence:0.24925
GC content 1 (%):52GC content 2 (%):47GC content divergence:-0.051
Length 1 (bp):1818Length 2 (bp):1890Length divergence:0.019
MFE 1 (kcal):-643.79MFE 2 (kcal):-630.22MFE divergence-0.011