Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049373-GRMZM2G128248
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192790
Function (paralog2):dnaJ protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.6903246059323
Log2 mRNA fold difference:-2.7782535715932
Log2 TE fold difference:1.0666915190484
Sequences
Protein sequence

MGNPPELYHKILNIPKDTSPHEIRAAYKNLVKKWHPDKHPPSSRPEAEARFKAISEAYEA
LLDQQENRGVFELCNDGRAGERTRGAFGGAGGGGGGGLGAGVGARMERTRSDGFCTRSAP
GTPAREFKKVYSSGDPGGRRAFAEFSSSIVRKAPPLERKLECTLEELCRGCKKEVSFTRD
VVTKNGSTVKKEVTQTVVVKPGWRKGKQVVLEGMGDERPGCLPGDAILTVSEKRHPAFKR
VGDDLVLKAEVPLVGALTGWSFSFRLLGGRKVSCSFQDEVVRPGYEKVIAGEGMPVPGQK
GARGDLRVKLDVVFPKELTPEQRAGLAEILRGSC*

MGNPPELYHKILNIPKDTSPQELRAAYKSLVKKWHPDKHPPSSRPEAEARFKAISEAYEA
LLDQQENRAVFGPCNGDRAGGGAGARVERTRSDGFCARSAPGTPARELKKVYSAGNPGGR
RAFAEFSSSIVRKAPPLERRLECTLEELCRGCSKEVTFTRDVVTRNGSIVKKEVTQTVQV
KPGWRKGKQVVLEGMGDERPGCLPGDAVLTVSERRHPAFKRVGDDLVLRAEVPLAGALTG
WSLSFRLLGGRKVTCSFEDEVIRPGHERVIRGEGMPVPGRKDGARGDLRVKLEVVFPTEL
SDEQRAGLAEILRGSC*

Other information
Ka divergence:0.367437KaKs divergence:-0.153165
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1005Length 2 (bp):951Length divergence:-0.028
MFE 1 (kcal):-514.27MFE 2 (kcal):-488.24MFE divergence-0.026