Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049422-GRMZM2G138429
Species:maize
Duplication type:WGD
Function (paralog1):tetraspanin family protein
Function (paralog2):hypothetical protein LOC100280216

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.8960276840004
Log2 mRNA fold difference:-0.97451723075535
Log2 TE fold difference:-0.91848034445016
Sequences
Protein sequence

MAACRGFFECLLRLLNFILTVAGLAMVGYGIYLLVEWMKISEDGSSGGLTAEVLVSGRPL
LGAVALGDSFLDMLPKAWFIYLFIGVGATVFLVSLFGCIGAGTRNTCCLCFYAFLVILLI
LAEAGAAAFIFFDHSWKDVIPVDKTHNFDVMYGFLKKNWEIARWVALGVVVFEAVLFLLA
LVVRAMNKPAEYDSDDEIIAIGRSPTMRQPLIHAQNVPATGVPVPTLDQRSSRNDAWSQR
MREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSRCTIM*

MAACRGFFECLLRLLNFILTVAGLAMVGYGIYLLVEWMKISEDGIGGASTAEVLVSGRPL
LGAVILGDSFLDNLPKAWFIYLFICVGTIVILVSLFGCIGAGTRNTCCLCFYAFLVILLI
LAEAAAAAFIFFDHGWKDVIPVDKTHNFDVMYDFLKENWEIARWVALGVVVFEAVLLLLA
LAVRAMNKPAEYDSDDEIIAIGRSPTIRQPLIHTQNVPATGVPVPTLDQRASRNDAWSQR
MREKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM*

Other information
Ka divergence:0.328386KaKs divergence:0.283563
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):840Length 2 (bp):840Length divergence:0
MFE 1 (kcal):-303.2MFE 2 (kcal):-295.33MFE divergence-0.013