Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049538-GRMZM2G093526
Species:maize
Duplication type:TD
Function (paralog1):terpene synthase1
Function (paralog2):hypothetical protein LOC100274033

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.6589893760392
Log2 mRNA fold difference:1.502957278072
Log2 TE fold difference:0.10182900576399
Sequences
Protein sequence

MAMPVKLTPASLSLKAVCCRFSSGGHALRFGSSLPCWRRTPTQRSTSSSTTRPAAEVSSG
KSKQHDQEASEATIRQQLQLVDVLENMGISRHFAAEIKCILDRTYRSWLQRHEEIMLDTM
TCAMAFRILRLNGYNVSSDELYHVVEASGLHNSLGGYLNDTRTLLELHKASTVSISEDES
ILDSIGSRSRTLLREQLESGGALRKPSLFKEVEHALDGPFYTTLDRLHHRWNIENFNIIE
QHMLETPYLSNQHTSRDILALSIRDFSSSQFTYQQELQHLESWVKECRLDQLQFARQKLA
YFYLSAAGTMFSPELSDARTLWAKNGVLTTIVDDFFDVAGSKEELENLVMLVEMWDEHHK
VEFYSEQVEIIFSSIYDSVNQLGEKASLVQDRSITKHLVEIWLDLLKSMMTEVEWRLSKY
VPTEKEYMINASLTFGLGPIVLPALYFVGPKISESIVKDPEYDELFKLMSTCGRLLNDVQ
TFEREYNEGKLNSVSLLVLHGGSMSISDAKRKLQKPIDTCRRDLLSLVLREESVVPRPCK
ELFWKMCKVCYFFYSTTDGFSSQVERAKEVDAVINEPLKLQGSHTLVSDV*

MAKPLNLTPAFLSLMATSCRFSSGGHAHRFASSLPCGRTTPTPRTTSSSTRPAAQVSPDR
SKQRDDEAASETTIRQQLQQVDVLENTGISRHFAGEIKCILDRTYRCWLERHEEIMQDTT
TCAMAFRILRMNGYDVSCDLLYHVVETSGIHDPLRGHLNDTRTLLELHKASTVSISEDES
ILDSIGLRSSTLLREQMESSGALQNPPLFREVEHALYHPFYATLDRLTHRWNIENFNTTE
HQMLDTPYLSSRYTSRDILALGIRDFNSSQLTYQQELQHLKSWVKECRLDQLPFVRQNLA
YFLLSAAGCMYSPELSEARTLCAKNGALITVVDDFFDVGGSKEELENLVMLVELWDEHRK
IEFYSEHVEIIFSSIYNSVNQYGAKASLLQDRNVTKHLVQIWLDLLKSMMTEVEWRLNKY
VPTEEEYMTNASLTFALGPIVLPALYFVGPKIPESIVKDPEYDELFKLMSTCGRLLNDVQ
SFEREYKEGKLNIVSLLVLHGGSMSISDARRKLQKPIDTCRRDLLRLVLREESVVPRPCK
ELFWKMCKVCYFFYSRTDGFRSPVERAKEVNAVINEPLKLQENHTHMSVL*

Other information
Ka divergence:0.108818KaKs divergence:0.387741
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1773Length 2 (bp):1773Length divergence:0
MFE 1 (kcal):-561.93MFE 2 (kcal):-544.04MFE divergence-0.016