Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049568-GRMZM2G036186
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304268
Function (paralog2):hypothetical protein LOC100280339

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVMGASGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCIPFREQLLEYYANN
KTPGDVEENLLTCLADLFMQISQAKKKTGVIAPKRFVQRVKKQNELFRSYMHQDAHEFLN
FLLNELVDILEKESSAAKDSPQSSSPEKAPNGPVQPLANGVKKEPPVTLVHKNFQGILTN
ETRCLRCETVTARDETFLDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEA
QKRMKIKKAPHILVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLSNTSDDVDTEYSLFAV
VVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEEQTLQTFFGSSHEYSGNTDHGYILF
YEGLGGKS*

MLAHEQKQQEPPQGESDSRSSESSRFIASEKGEKSATEEAAATAIPSSYLSLRSRTRIDP
SRVLHRPPASSYPSPLPPPRARAGSHQTLGRQIRCDHPRWRPRRRPRGAAQGSGQGSGTS
PAPPLAGGTGGWSWEPAAPSLRRPSETSSRKASATSASRTSATPATATVSFREQLLEYYA
NNKTPGDAEENLLTCLADLFMQISQAKKKTGVIAPKRFVQRVKKQNELFRSYMHQDAHEF
LNFLLNELVDILEKESSAAKDSPQSSSPEKAPNGPVQPLANGVKKEPPVTLVHKSFQGIL
TNETRCLRCETVTARDETFLDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQ
EAQKRMKIKKAPHILVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLSNSSDDVDTEYSLF
AVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEEQTLQTFFGTSHEYSGNTDHGYI
LFYEGLGGKS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):49GC content divergence:0.065
Length 1 (bp):1107Length 2 (bp):1473Length divergence:0.142
MFE 1 (kcal):-348.7MFE 2 (kcal):-496.21MFE divergence0.175