Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049675-GRMZM2G128219
Species:maize
Duplication type:WGD
Function (paralog1):gibberellin receptor GID1L2
Function (paralog2):gibberellin receptor GID1L2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.67279786444495
Log2 mRNA fold difference:-1.2222412850225
Log2 TE fold difference:1.9005171889004
Sequences
Protein sequence

MAPSKPLFPVAVPAPDPSDEVVREFGPLLRIYKSGRIERPLVAPPVEPGHDAATGVQSKD
VHLGSYSARLYLPPSAGAGAKLPVVVYVHGGGFVAESAASPNYHLFLNRLAAACPALAVS
VDYRLAPEHPLPAGYDDCLAALKWVLSAADPWVAAHGDLARVFVAGDSAGGNVCHHLAIH
PDVVQAQRARQAGAPPLKGAVLIHPWFWGSEAVGEEPRDPAARAMGVGLWLFACPETNGL
DDPRMNPLAPAAPGLHTLACERVMVCAAEGDFLRWRGRAYAEAVAAARGGDLGEAAGVEL
LETMGEGHVFFLFKPDCYEAKEMMHKMVAFINAP*

MASSKPLFPFPVPAPDPSDEVVREFGPLLRVYKSGRIERPLVAPPVEPGHDAATGVQSKD
VHLGSYSARLYLPPVADAGAKLPVVVFVHGGGFVAESAASPNYHLFLNRLAAACPALAVS
VDYRLAPEHPLPAGYDDCLAALKWVLSAADPWVAAHGDLARVFVAGDSAGGNVCHYLAIH
PDVVQAQQQGCPPPLKGAVLIHPWFWGSEAVGEEPRDPAVRTMGAGLWFFACPDANSMED
PRMNPMAPAAPGLHTLACERVMVCTAEGDFLRWRGRAYAEAVAAARGGRLGQAAGVELLE
TMGEGHVFFLFKPDCDKAKEMLDKMAAFINAP*

Other information
Ka divergence:0.0424165KaKs divergence:-0.999914
GC content 1 (%):73GC content 2 (%):71GC content divergence:-0.014
Length 1 (bp):1005Length 2 (bp):999Length divergence:-0.003
MFE 1 (kcal):-524.49MFE 2 (kcal):-515.92MFE divergence-0.008