Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049767-GRMZM2G158232
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100382429
Function (paralog2):16.9 kDa class I heat shock protein 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:5.2157323470628
Log2 mRNA fold difference:4.7162975332606
Log2 TE fold difference:0.61413172540292
Sequences
Protein sequence

MSPASSSNPLSLDFWASSADPFGVVRPLAEQCPVLTNVRVDWKETPEAHVFRADLPGVRK
EAAKVEVEDGNVLVISGERAREEEEAGKDEAWRWRLVERSSGRFQRRFRLPRGARLDQVH
ASMENGVLTVTVPKEEAKKPQVRAVEISG*

MSLVRRSNVFDPFSMDLWDPFDTMFRSIVPSATSTNSETAAFASARIDWKETPEAHVFKA
DLPGVKKEEVKVEVEDGNMLVISGQRSREKEDKDDKWHRVERSSGQFVRRFRLPENTKVD
QVKAGLENGVLTVTVPKAEEKKPEVKAIEISG*

Other information
Ka divergence:-0.655696KaKs divergence:0.216393
GC content 1 (%):70GC content 2 (%):63GC content divergence:-0.053
Length 1 (bp):450Length 2 (bp):459Length divergence:0.01
MFE 1 (kcal):-224.8MFE 2 (kcal):-183.34MFE divergence-0.102