Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049866-GRMZM5G803433
Species:maize
Duplication type:WGD
Function (paralog1):heterogeneous nuclear ribonucleoprotein A3-like protein 2
Function (paralog2):hypothetical protein LOC100382178

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.2993874489364
Log2 mRNA fold difference:0.20067634590551
Log2 TE fold difference:1.1076692823582
Sequences
Protein sequence

MDPFSKKRKPDENGAVTASPAGGAATLGLTRDDVIRLLEPLSRDQLADIAAAAALVSSQA
LDAVRAAADRDPALRKLFVRGLGWETTSDSLRAIFSAYGDLEEAVVITDKPTGRSKGYGF
VTFRHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPAGGPAGSGGAPVSDVSLRKIFV
GNVPADMASERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVDTVKV
IDGHQLVCKLALDGKKEKQGQSQQPGPGNHQQQQILPGGPQDIQGGLGLGSQMGAQYGVP
GTGMPSFGFGGVGGGFGGPNPYGNMPSSMGGGGAGGLGSMGGQVPSGLASAGAGAFGPGG
LGGGSFGVSSQFGAAGMGAYGGLGIGGGSMYRIQQGAGGLPAGTFGDGGSYPPPGSGFRG
QDPQGGMSPPGPGGRAPPMYPNVPPYF*

MDPFSKKRKPDDNGAVTASPAGGAATLGLTREDVLRLLEPLSRDQLADIAAAAALVSAHA
LDAVRAAADRDPALRKLFIRGLGWETTSDSLRAIFSAYGDLEEAVVITDKSTGRSKGYGF
VTFRHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPSVGAPGSGGAPVADVSLRKIFV
GNVPADMSSERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVDSVKV
IDSHQLVCKLAIDGKKGKQGQSQQSGPGNQQQQQQQQMLPGGPQEIQGGLGLGSQMGAQY
GGPGSGMPSFGFGGVGGGFGGPNPYANMPSSMGGGGAGGLGSVGGQVPTGLAGAGGFGPG
GLGGGSFGGSSQFGAAGMGAYGGLGMGGGSMYRMQQGAGGLPAGAFGEGGNYPLPGSGFR
GHDPQGGMSPPGPGGRAPPMYPNVPPYF*

Other information
Ka divergence:-0.414059KaKs divergence:-0.317588
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):1344Length 2 (bp):1347Length divergence:0.001
MFE 1 (kcal):-605.06MFE 2 (kcal):-616.91MFE divergence0.01