Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049877-GRMZM2G143756
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1435148729148
Log2 mRNA fold difference:-0.74475141226465
Log2 TE fold difference:-0.65148720441692
Sequences
Protein sequence

MAPAVQDRLPFLASPPAPPPARERGRNPSLAEMLRLVGAATTTVDTADDDGTASVFSLPL
ALATTPGRDAVAGGASATTIARTVHFRLAFSNLTYSVRAKQRRRGPSLPLQSRVTAAAAA
AAPDARAPRTRALLDGVSGEAREGEILAVMGASGSGKSTLIDALANRISRDALKGAVTLN
GEPLVGDIIKSISAYVMQDDLLFPTLTVTETLSFAAEFRLPRALPPAKKRARVQALIDQL
GLRAAADTIIGDEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVKVL
RRIAESGSIVITSIHQPSQRILGLLDRLILLSGGQTVFSGPPSALPSYFAEFGFPVPDDE
NRAEFALDLIREFESSPTGTKPLVDFHRTWQHMHARSHGQGSAGAAGQTLAATAPTMPLK
EAISASISRGKLVLGSDGVAGEAASVRTYANPFWVEMKVLTKRSAINTRRMPELFLIRLG
AVVVTGAILATVFFRLDQSPKGAQERLGFFAFAMSTMFYTCADALPVFLQERYVFLRETA
YGAYRRASYVLSNAIVSFPPIVVLSLAFAFTTFFAVGLAGGVSGFAFYTLAILASFWAGS
GFVTFLSGVIPHVMIGYTVVVAILAYFLLFTGFFINRDRIPAYWIWFHYLSLIKYPFEGV
LQNEFGRGGECFVRGAQMFDNSPLAGLPDAVKGRVLASISSALGVRIGADTCVVTGRGVL
HQAAVTQLGKWECLLVTMAWGFLFRILFYFSLVLGSKNKRR*

MAPAVQDRLPFLASPPPARERGRNPSLAEMLRLVGAATVDPADDDGSASAFSLPLPHATT
TPDRDAVAGVAGATAIGRTVHFRLAFSSLTYSVRAKQHGRGGPGPGLLPLQRRSDRVTTR
ALLDGVSGDAREGEILAVMGASGSGKSTLIDALAHRISRDALKGAVTLNGEPLTGAVLKS
ISAYVMQDDLLFPMLTVAETLSFAAEFRLPRALSPAKKRARVQALIDQLGLRAAAGTIIG
DEGHRGVSGGERRRVSIGTDIIHDPILLFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVI
TSIHQPSQRILGLLDRLILLSGGRTVFSGPPSALPSYFAEFGFPVPDDENRAEFALDLIR
ELESSPTGTKPLVDFQRTWQLMHARTTSPAAAQGDGGSAMSLKEAISASISRGKLVSGSD
VAGEAASVRTYANPFWVEMKVLTKRSAINTRRMPELFLIRLGAVVVTGAILATVFFRLDQ
SPKGAQERLGFFAFAMSTMYYTCADALPVFLQERYVFLRETAYGAYRRASYVLSNALVSF
PPLVVLSLAFALTTFFAVGLAGGVPGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYT
VVVAILAYFLLFSGFFITRDRIPPYWIWFHYLSLIKYPFEGVLQNEFGRGGECFVRGAQI
FDNSPLAGLPDAVKARVLASISSALGVGIGADTCVVTGRGVLQQAAVTQLGKWECLLVTM
AWGFLFRILFYFSLVLGSKNKRR*

Other information
Ka divergence:-0.282106KaKs divergence:-0.325261
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):2286Length 2 (bp):2232Length divergence:-0.012
MFE 1 (kcal):-1121.31MFE 2 (kcal):-1114MFE divergence-0.003