Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G049912-GRMZM5G883250
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192756
Function (paralog2):hypothetical protein LOC100193298

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.529535741241
Log2 mRNA fold difference:-0.16812143222596
Log2 TE fold difference:-1.4327638854389
Sequences
Protein sequence

MELFARAKVVRLKSHHDKFLYADEDEAHVTQERDGSSANARWAVEPAPHNPGAIRLRSRY
GHYLTASGEPFLLGMTGRKVTQTAPAAPRPANASVDWEPVRDGFQARLRTRAGHFLRANG
GLPPWRNSVTHDVPHRTATQDWVLWDVEVVQLLTPAPPDRAGSAPLAKLPDSPPAPELAN
PPQPHHRPSKSYAAPPPPPTLEPEAPPPRLSKLESSDSFSAPLHKVEGRAIHYHIADDLG
NVQDGTVGHSFTFNGSNLEELAHKLQEETGLDNIIICTRSPINGKLTPLRLQLPPNNAAM
HIVLVQESSKVARSFARPYGS*

MELFARAKVVRLRSHHDKFLYADEDEVRVTQDRDGSSANARWTVEAAPHSAGAVRLRSRY
GRYLTASGEPFLLGMTGRKVRQTAPAAPRPANASVDWEPLRDGFQARLRTKAGHFLRANG
GLPPWRNSVTHDVPHRTATQDWVLWDVEVVQLLTPAPRPERTGSAPVAKLPDSPPAPDLG
KPPQAHGPHHRPSKSYATPPPTLEPVAPPPPPPPPSRLNKLESSLSFSAPLHKVEGRAIH
YHIADDLGNVDEGTVGHSFTFNGSNLEELAHKLQEETGLEDIIICTRSPINGKLTPLRLQ
LPPNNAAMHIVLVQESSKVAKSFPWPYGS*

Other information
Ka divergence:0.0390293KaKs divergence:-0.0477499
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):966Length 2 (bp):990Length divergence:0.012
MFE 1 (kcal):-449.4MFE 2 (kcal):-471.7MFE divergence0.024