Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050512-GRMZM2G377904
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.6271950944382
Log2 mRNA fold difference:0.38374426176679
Log2 TE fold difference:1.2436767798588
Sequences
Protein sequence

MLRAVARCCGHWPPGAAAADGMLWQTELRPHAAGEFSMAAAQANLTMEDQAQVLASPSAT
LVGVYDGHGGVDASRFLRSGLFPHVQRFAREQGGISAEAIRSAFGAAEEEFHRQVRQEWA
RRPRLAAVGSCCLLGAISGDTLYVANLGDSRAVLGRRVGGGGGGAAVAERLSAEHNAASE
EVRRELAALNPDDAQIVVHARGAWRVKGIIQVSRSIGDFYLKKPEYSLDPLFRQVGPPIA
LKRPALSAEPSVQVRKLKPNDLFLIFASDGLWEHLSDDAAVQIVFKNPRTGIANRLVKAA
LKEAARKREVRYRDLRTIDKGVRRHFHDDISVVVVFLDRHRERRHTRVVDSSSNCISAPV
DIYSSNTHQSAEPLHG*

MLRALAARCCGHWPPGAAAADGMLWQAELRPHAAGEFSMAAAQANLAMEDQAQVLASPAA
TLVGVYDGHGGADASRFLRSRLFLHVQRVVQEQGGMSAEAIRSAFGAAEEEFHRQVRQEW
RSRPRLAAVGSCCLLGAISGDTLYVANAGDSRAVLGRRVPGGGAAVAERLSAEHNAACEE
VRRELAALNPDDAQIVVHARGAWRVKGIIQVSRSIGDFYLKKPEYSLDPLFRQVGAPIAL
KRPALSAEPSVQVRKLKPNDLFLIFASDGLWEHLSDDAAVQIVFKNPRTGIASRLVKAAL
KEATRKREVRYRDLRTIERGVRRHFHDDISVVVVYLDGHRERRHTRVVDSSSNCTSAPVD
IHSSNSR*

Other information
Ka divergence:0.253972KaKs divergence:0.156798
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):1131Length 2 (bp):1104Length divergence:-0.012
MFE 1 (kcal):-575.4MFE 2 (kcal):-569.5MFE divergence-0.005